Protein Family IF04519

Metagenome Isolate
175 Members
55 Samples
167 Scaffolds
287.54 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_181924|Ga0466690_181924_1058_1993
Length
311 aa
Sequence
MCFKPLKKHFVKNKEKIMEKIGFIGLGIMGRPMAKNLIKAGYKLVVYDKFAKLDDVVALGAEGAASSKEVAAKSDIIITMLPNSPHVQEAVCGVDGILEGVKRGAIVVDMSSIAPAVSQEVGVALKSKGVAFLDAPVSGGEPKAIDGTLAIMVGGDKAPFDTVKPILEKMGSSVTFVGGIGSGNVTKLANQIIVALNIAAVSEALVLATKAGVDPQLVFDAIKGGLAGSTVMNAKVPMILDGNFKPGFRIELHIKDLQNALDTAHTLGVPIPLTASVMETLQALKNDGCAANDHSAIVKFYEKLAQIEVRK

📊 Sample Types

Isolate 4.6%
Metagenome 95.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Kalotermitidae 26.4%
Unclassified 17.0%
Rhinotermitidae 7.5%
Termopsidae 7.5%

🌳 Taxonomy

Archaea 0
Bacteria 170
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
26 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
27 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
41 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
44 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
45 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
48 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
49 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
50 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
51 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
52 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
53 650716102 Treponema primitia ZAS-2 Isolate Unclassified
54 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
55 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_005355 3300042612 Bacteria 12648
2 Ga0466705_203426 3300042612 Bacteria 12940
3 Ga0466733_004919 3300042659 Bacteria 1985
4 Ga0264413_112494 3300024493 Bacteria 4000
5 Ga0466691_015239 3300042593 Bacteria 10240
6 Ga0466691_200114 3300042593 Bacteria 17588
7 Ga0466694_173188 3300042594 Bacteria 2189
8 Ga0466699_262886 3300042597 Bacteria 3918
9 Ga0466712_048935 3300042614 Bacteria 6271
10 Ga0466711_075373 3300042615 Bacteria 27057
11 Ga0466711_452483 3300042615 Bacteria 4287
12 Ga0466723_043323 3300042618 Bacteria 23308
13 Ga0466728_036752 3300042620 Bacteria 3982
14 Ga0466728_122472 3300042620 Bacteria 2815
15 Ga0466703_079401 3300042636 Bacteria 4221
16 Ga0466703_164185 3300042636 Bacteria 13810
17 Ga0466704_153012 3300042643 Bacteria 54848
18 Ga0466727_189288 3300042655 Bacteria 1328
19 Ga0466705_026349 3300042612 Bacteria 21268
20 Ga0456237_0004106 3300041968 Bacteria 2343
21 Ga0466692_062140 3300042591 Bacteria 6358
22 Ga0466691_053921 3300042593 Bacteria 3822
23 Ga0466691_109493 3300042593 Bacteria 23172
24 Ga0466715_617084 3300042616 Bacteria 12140
25 Ga0466718_010396 3300042617 Bacteria 2029
26 Ga0466726_188860 3300042619 Bacteria 5521
27 Ga0466728_313247 3300042620 Bacteria 1243
28 Ga0466700_373983 3300042600 Bacteria 2027
29 Ga0466707_059531 3300042601 Bacteria 3517
30 Ga0466707_136297 3300042601 Bacteria 1242
31 Ga0466719_048024 3300042606 Bacteria 5002
32 Ga0466698_044560 3300042610 Bacteria 1326
33 Ga0123357_10093179 3300009784 Bacteria 3916
34 Ga0123355_10626340 3300009826 Bacteria 1266
35 Ga0123354_10233209 3300010882 Unclassified 1917
36 Ga0466702_240393 3300042635 Bacteria 2392
37 Ga0466703_207668 3300042636 Bacteria 20271
38 Ga0466692_154679 3300042591 Bacteria 3064
39 Ga0466699_030314 3300042597 Bacteria 7653
40 Ga0466711_227825 3300042615 Bacteria 191336
41 Ga0466715_116296 3300042616 Bacteria 10085
42 Ga0466723_364979 3300042618 Bacteria 7946
43 Ga0466719_496478 3300042606 Bacteria 1931
44 Ga0466720_028434 3300042607 Bacteria 9245
45 Ga0466720_180472 3300042607 Bacteria 1547
46 Ga0466721_402319 3300042608 Bacteria 1820
47 Ga0466722_094174 3300042609 Bacteria 17191
48 Ga0123357_10098389 3300009784 Bacteria 3782
49 Ga0123357_10136366 3300009784 Bacteria 3034
50 Ga0123357_10353618 3300009784 Bacteria 1402
51 JGI24698J34947_10000869 3300002449 Bacteria 15238
52 JGI24698J34947_10007167 3300002449 Bacteria 6127
53 JGI24698J34947_10007225 3300002449 Bacteria 6103
54 JGI24698J34947_10021591 3300002449 Bacteria 3459
55 Ga0068302_10106298 3300005071 Bacteria 2734
56 Ga0072941_1153283 3300005201 Bacteria 2524
57 Ga0466735_097398 3300042624 Bacteria 1586
58 Ga0466709_241383 3300042648 Bacteria 9731
59 Ga0466708_019718 3300042652 Bacteria 4629
60 Ga0466708_049135 3300042652 Bacteria 6152
61 Ga0466727_209185 3300042655 Bacteria 3426
62 Ga0466705_019218 3300042612 Bacteria 5585
63 Ga0466705_080473 3300042612 Bacteria 1208
64 Ga0466732_101831 3300042656 Bacteria 9208
65 Ga0264413_121981 3300024493 Bacteria 3952
66 Ga0456237_0003278 3300041968 Bacteria 2630
67 Ga0466694_346929 3300042594 Bacteria 2252
68 Ga0466726_188013 3300042619 Bacteria 2961
69 Ga0466726_226051 3300042619 Bacteria 1467
70 Ga0466707_006801 3300042601 Bacteria 9423
71 Ga0466707_135155 3300042601 Bacteria 2692
72 Ga0466707_265237 3300042601 Bacteria 1444
73 Ga0466707_311419 3300042601 Bacteria 1072
74 Ga0123357_10063583 3300009784 Bacteria 4935
75 Ga0123353_10278755 3300010167 Bacteria 2569
76 JGI24695J34938_10118233 3300002450 Bacteria 1079
77 JGI24705J35276_12224728 3300002504 Bacteria 2641
78 Ga0074263_107152 3300005485 Bacteria 2132
79 Ga0074263_110497 3300005485 Bacteria 1895
80 Ga0466704_151352 3300042643 Bacteria 18052
81 Ga0466705_030939 3300042612 Bacteria 5057
82 Ga0466705_324741 3300042612 Bacteria 3382
83 Ga0264413_120307 3300024493 Bacteria 8770
84 Ga0415639_233863 3300038395 Bacteria 1942
85 Ga0466690_181924 3300042590 Bacteria 4472
86 Ga0466696_009446 3300042596 Bacteria 7280
87 Ga0466699_002401 3300042597 Bacteria 74503
88 Ga0466699_051861 3300042597 Bacteria 28735
89 Ga0466712_203641 3300042614 Bacteria 18970
90 Ga0466718_119242 3300042617 Bacteria 1614
91 Ga0466723_158968 3300042618 Bacteria 7540
92 Ga0466700_398054 3300042600 Bacteria 1965
93 Ga0466707_169883 3300042601 Bacteria 3293
94 Ga0466707_206106 3300042601 Bacteria 3562
95 Ga0466707_363851 3300042601 Bacteria 1454
96 Ga0466719_149555 3300042606 Bacteria 1831
97 Ga0123357_10019092 3300009784 Bacteria 9127
98 Ga0466735_165528 3300042624 Unclassified 1227
99 Ga0466703_194546 3300042636 Bacteria 15604
100 Ga0466704_149556 3300042643 Bacteria 3103
101 Ga0466704_240823 3300042643 Bacteria 65386
102 Ga0466709_344833 3300042648 Bacteria 5951
103 Ga0466708_395619 3300042652 Bacteria 1617
104 Ga0466727_205836 3300042655 Bacteria 2042
105 Ga0264413_124902 3300024493 Bacteria 1475
106 Ga0466711_230349 3300042615 Bacteria 7865
107 Ga0466711_295767 3300042615 Bacteria 2255
108 Ga0466715_080822 3300042616 Unclassified 1928
109 Ga0466718_006033 3300042617 Bacteria 1283
110 Ga0466718_148910 3300042617 Bacteria 34374
111 Ga0466719_187816 3300042606 Bacteria 6299
112 Ga0466719_308770 3300042606 Bacteria 1954
113 Ga0466719_476121 3300042606 Bacteria 3630
114 Ga0466722_028834 3300042609 Bacteria 11353
115 Ga0466722_130397 3300042609 Bacteria 4800
116 Ga0466722_174138 3300042609 Bacteria 6431
117 Ga0123353_10286172 3300010167 Bacteria 2527
118 JGI24698J34947_10034345 3300002449 Bacteria 2655
119 Ga0466735_172229 3300042624 Bacteria 1134
120 Ga0466727_048249 3300042655 Bacteria 2270
121 Ga0466727_133301 3300042655 Unclassified 1871
122 Ga0466705_084782 3300042612 Bacteria 24449
123 Ga0466732_299776 3300042656 Bacteria 1917
124 Ga0466692_036251 3300042591 Bacteria 1734
125 Ga0466696_041928 3300042596 Bacteria 3096
126 Ga0466699_420595 3300042597 Bacteria 1193
127 Ga0466699_441937 3300042597 Unclassified 1834
128 Ga0466712_259666 3300042614 Bacteria 1284
129 Ga0466711_019592 3300042615 Bacteria 3693
130 Ga0466711_364247 3300042615 Bacteria 2616
131 Ga0466723_365927 3300042618 Bacteria 3222
132 Ga0466719_011078 3300042606 Bacteria 4082
133 Ga0466722_265261 3300042609 Bacteria 13661
134 Ga0123353_10447637 3300010167 Bacteria 1903
135 Ga0123354_10129489 3300010882 Bacteria 3197
136 JGI24698J34947_10000035 3300002449 Bacteria 37551
137 JGI24700J35501_10930826 3300002508 Bacteria 25995
138 Ga0466703_059273 3300042636 Bacteria 6514
139 Ga0466703_065065 3300042636 Bacteria 10516
140 Ga0466709_226586 3300042648 Bacteria 1357
141 Ga0466709_285745 3300042648 Bacteria 6318
142 Ga0466708_137817 3300042652 Bacteria 1053
143 Ga0466708_231552 3300042652 Bacteria 11100
144 Ga0466727_128066 3300042655 Bacteria 2117
145 Ga0466705_275736 3300042612 Bacteria 3581
146 Ga0466690_400678 3300042590 Bacteria 2647
147 Ga0466692_063216 3300042591 Bacteria 3496
148 Ga0466694_153774 3300042594 Bacteria 1594
149 Ga0466712_276705 3300042614 Bacteria 1227
150 Ga0466715_037932 3300042616 Bacteria 49289
151 Ga0466718_156391 3300042617 Bacteria 9739
152 Ga0466723_358872 3300042618 Bacteria 4629
153 Ga0466726_412452 3300042619 Bacteria 1895
154 Ga0466728_295881 3300042620 Bacteria 18247
155 Ga0466729_178881 3300042621 Bacteria 2917
156 Ga0466716_197339 3300042605 Bacteria 2444
157 Ga0123353_10497507 3300010167 Bacteria 1777
158 Ga0123354_10337934 3300010882 Bacteria 1362
159 AustNasuHG_c1021036 3300000089 Bacteria 2117
160 JGI24695J34938_10041613 3300002450 Bacteria 2062
161 Ga0072941_1074299 3300005201 Bacteria 2614
162 Ga0466703_025704 3300042636 Bacteria 95958
163 Ga0466703_131027 3300042636 Bacteria 2481
164 Ga0466703_318127 3300042636 Bacteria 2493
165 Ga0466727_010059 3300042655 Bacteria 12059
166 Ga0466727_074292 3300042655 Bacteria 1682
167 Ga0466727_195003 3300042655 Bacteria 6162

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_131027 Ga0466703_131027_226_1116 251
2 3300042601 Ga0466707_136297 Ga0466707_136297_73_954 253
3 3300042601 Ga0466707_311419 Ga0466707_311419_294_1055 253
4 3300042616 Ga0466715_080822 Ga0466715_080822_1006_1887 253
5 3300042648 Ga0466709_241383 Ga0466709_241383_1643_2524 253
6 3300042612 Ga0466705_084782 Ga0466705_084782_3760_4644 254
7 3300042636 Ga0466703_164185 Ga0466703_164185_9550_10431 254
8 3300042618 Ga0466723_158968 Ga0466723_158968_5326_6207 255
9 3300042619 Ga0466726_188860 Ga0466726_188860_1126_2007 255
10 3300042655 Ga0466727_209185 Ga0466727_209185_948_1829 255
11 3300005071 Ga0068302_10106298 Ga0068302_101062982 256
12 3300042612 Ga0466705_005355 Ga0466705_005355_9670_10551 256
13 3300042612 Ga0466705_026349 Ga0466705_026349_19868_20752 256
14 3300042612 Ga0466705_275736 Ga0466705_275736_1711_2592 256
15 3300042605 Ga0466716_197339 Ga0466716_197339_1082_1978 258
16 3300042606 Ga0466719_048024 Ga0466719_048024_2973_3854 258
17 3300042652 Ga0466708_049135 Ga0466708_049135_3555_4451 258
18 3300042615 Ga0466711_227825 Ga0466711_227825_20051_20941 259
19 3300042617 Ga0466718_156391 Ga0466718_156391_1481_2368 259
20 3300042618 Ga0466723_358872 Ga0466723_358872_1405_2286 261
21 3300009784 Ga0123357_10063583 Ga0123357_100635832 262
22 3300042652 Ga0466708_231552 Ga0466708_231552_3786_4667 262
23 3300042591 Ga0466692_063216 Ga0466692_063216_33_911 264
24 3300042636 Ga0466703_318127 Ga0466703_318127_1147_2028 264
25 3300038395 Ga0415639_233863 Ga0415639_233863_981_1781 266
26 3300042606 Ga0466719_496478 Ga0466719_496478_884_1774 266
27 3300042590 Ga0466690_400678 Ga0466690_400678_1594_2514 270
28 3300042636 Ga0466703_207668 Ga0466703_207668_12496_13335 270
29 3300042648 Ga0466709_285745 Ga0466709_285745_4363_5202 274
30 3300009826 Ga0123355_10626340 Ga0123355_106263401 277
31 3300042597 Ga0466699_420595 Ga0466699_420595_149_988 279
32 3300042612 Ga0466705_324741 Ga0466705_324741_436_1275 279
33 3300042614 Ga0466712_048935 Ga0466712_048935_3452_4291 279
34 3300042614 Ga0466712_203641 Ga0466712_203641_8941_9780 279
35 3300042614 Ga0466712_259666 Ga0466712_259666_155_994 279
36 3300042616 Ga0466715_037932 Ga0466715_037932_39477_40316 279
37 3300042655 Ga0466727_010059 Ga0466727_010059_4345_5184 279
38 3300042609 Ga0466722_174138 Ga0466722_174138_647_1489 280
39 3300042621 Ga0466729_178881 Ga0466729_178881_35_916 281
40 3300042601 Ga0466707_265237 Ga0466707_265237_518_1369 283
41 3300042618 Ga0466723_365927 Ga0466723_365927_556_1407 283
42 3300042655 Ga0466727_205836 Ga0466727_205836_610_1461 283
43 3300042609 Ga0466722_130397 Ga0466722_130397_2930_3811 284
44 3300042591 Ga0466692_036251 Ga0466692_036251_781_1662 285
45 3300042607 Ga0466720_028434 Ga0466720_028434_3339_4220 286
46 3300042593 Ga0466691_109493 Ga0466691_109493_18450_19340 291
47 3300042648 Ga0466709_344833 Ga0466709_344833_1757_2656 291
48 3300024493 Ga0264413_112494 Ga0264413_1124943 293
49 3300024493 Ga0264413_120307 Ga0264413_1203073 293
50 3300024493 Ga0264413_121981 Ga0264413_1219812 293
51 3300024493 Ga0264413_124902 Ga0264413_1249022 293
52 3300041968 Ga0456237_0003278 Ga0456237_0003278_699_1580 293
53 3300042591 Ga0466692_062140 Ga0466692_062140_3475_4356 293
54 3300042591 Ga0466692_154679 Ga0466692_154679_1489_2370 293
55 3300042593 Ga0466691_015239 Ga0466691_015239_4586_5467 293
56 3300042593 Ga0466691_200114 Ga0466691_200114_6794_7675 293
57 3300042596 Ga0466696_009446 Ga0466696_009446_184_1065 293
58 3300042600 Ga0466700_398054 Ga0466700_398054_982_1863 293
59 3300042601 Ga0466707_006801 Ga0466707_006801_2969_3850 293
60 3300042601 Ga0466707_059531 Ga0466707_059531_1689_2570 293
61 3300042601 Ga0466707_206106 Ga0466707_206106_2484_3365 293
62 3300042601 Ga0466707_363851 Ga0466707_363851_492_1373 293
63 3300042606 Ga0466719_011078 Ga0466719_011078_2750_3631 293
64 3300042606 Ga0466719_187816 Ga0466719_187816_4883_5764 293
65 3300042606 Ga0466719_308770 Ga0466719_308770_242_1123 293
66 3300042606 Ga0466719_476121 Ga0466719_476121_356_1237 293
67 3300042607 Ga0466720_180472 Ga0466720_180472_506_1387 293
68 3300042609 Ga0466722_094174 Ga0466722_094174_1006_1887 293
69 3300042609 Ga0466722_265261 Ga0466722_265261_5234_6115 293
70 3300042612 Ga0466705_019218 Ga0466705_019218_3497_4378 293
71 3300042612 Ga0466705_030939 Ga0466705_030939_747_1628 293
72 3300042612 Ga0466705_203426 Ga0466705_203426_10750_11631 293
73 3300042615 Ga0466711_019592 Ga0466711_019592_529_1410 293
74 3300042615 Ga0466711_075373 Ga0466711_075373_2355_3236 293
75 3300042615 Ga0466711_295767 Ga0466711_295767_1284_2165 293
76 3300042615 Ga0466711_452483 Ga0466711_452483_717_1598 293
77 3300042616 Ga0466715_617084 Ga0466715_617084_9246_10127 293
78 3300042617 Ga0466718_006033 Ga0466718_006033_73_954 293
79 3300042617 Ga0466718_010396 Ga0466718_010396_745_1626 293
80 3300042618 Ga0466723_043323 Ga0466723_043323_16310_17191 293
81 3300042618 Ga0466723_364979 Ga0466723_364979_6922_7803 293
82 3300042619 Ga0466726_226051 Ga0466726_226051_215_1096 293
83 3300042620 Ga0466728_036752 Ga0466728_036752_2677_3558 293
84 3300042620 Ga0466728_295881 Ga0466728_295881_8155_9036 293
85 3300042624 Ga0466735_097398 Ga0466735_097398_373_1254 293
86 3300042624 Ga0466735_165528 Ga0466735_165528_145_1026 293
87 3300042624 Ga0466735_172229 Ga0466735_172229_122_1003 293
88 3300042636 Ga0466703_059273 Ga0466703_059273_1032_1913 293
89 3300042636 Ga0466703_065065 Ga0466703_065065_3066_3947 293
90 3300042636 Ga0466703_194546 Ga0466703_194546_13957_14838 293
91 3300042643 Ga0466704_153012 Ga0466704_153012_43709_44590 293
92 3300042643 Ga0466704_240823 Ga0466704_240823_27688_28569 293
93 3300042648 Ga0466709_226586 Ga0466709_226586_30_911 293
94 3300042652 Ga0466708_019718 Ga0466708_019718_378_1259 293
95 3300042652 Ga0466708_395619 Ga0466708_395619_554_1435 293
96 3300042655 Ga0466727_048249 Ga0466727_048249_1280_2161 293
97 3300042655 Ga0466727_074292 Ga0466727_074292_685_1566 293
98 3300042655 Ga0466727_128066 Ga0466727_128066_526_1407 293
99 3300042656 Ga0466732_299776 Ga0466732_299776_703_1584 293
100 iso_pr_bacteria 2819994798 2819997606 293
101 iso_pr_bacteria 650716102 650883363 293
102 3300000089 AustNasuHG_c1021036 AustNasuHG_10210362 294
103 3300002450 JGI24695J34938_10041613 JGI24695J34938_100416132 294
104 3300002508 JGI24700J35501_10930826 JGI24700J35501_1093082615 294
105 3300005201 Ga0072941_1074299 Ga0072941_10742992 294
106 3300005201 Ga0072941_1153283 Ga0072941_11532833 294
107 3300005485 Ga0074263_107152 Ga0074263_1071522 294
108 3300005485 Ga0074263_110497 Ga0074263_1104972 294
109 3300042594 Ga0466694_173188 Ga0466694_173188_343_1227 294
110 3300042596 Ga0466696_041928 Ga0466696_041928_20_904 294
111 3300042606 Ga0466719_149555 Ga0466719_149555_666_1550 294
112 3300042610 Ga0466698_044560 Ga0466698_044560_75_959 294
113 3300042614 Ga0466712_276705 Ga0466712_276705_287_1171 294
114 3300042619 Ga0466726_412452 Ga0466726_412452_139_1023 294
115 3300042635 Ga0466702_240393 Ga0466702_240393_799_1683 294
116 3300042636 Ga0466703_079401 Ga0466703_079401_3192_4076 294
117 3300042643 Ga0466704_149556 Ga0466704_149556_126_1010 294
118 3300042643 Ga0466704_151352 Ga0466704_151352_11841_12725 294
119 3300042655 Ga0466727_133301 Ga0466727_133301_418_1302 294
120 3300042655 Ga0466727_189288 Ga0466727_189288_192_1076 294
121 3300042655 Ga0466727_195003 Ga0466727_195003_1327_2211 294
122 3300042656 Ga0466732_101831 Ga0466732_101831_704_1588 294
123 3300042659 Ga0466733_004919 Ga0466733_004919_512_1396 294
124 iso_pr_bacteria 2781125632 2781269770 294
125 iso_pr_bacteria 2781125652 2781310980 294
126 iso_pr_bacteria 2781125655 2781318220 294
127 iso_pr_bacteria 2781125688 2781424396 294
128 iso_pr_bacteria 2820483401 2820483648 294
129 3300002449 JGI24698J34947_10000035 JGI24698J34947_1000003531 295
130 3300002449 JGI24698J34947_10000869 JGI24698J34947_1000086910 295
131 3300002449 JGI24698J34947_10007167 JGI24698J34947_100071674 295
132 3300002449 JGI24698J34947_10007225 JGI24698J34947_100072253 295
133 3300002449 JGI24698J34947_10021591 JGI24698J34947_100215912 295
134 3300002449 JGI24698J34947_10034345 JGI24698J34947_100343452 295
135 3300002450 JGI24695J34938_10118233 JGI24695J34938_101182331 295
136 3300002504 JGI24705J35276_12224728 JGI24705J35276_122247283 295
137 3300009784 Ga0123357_10093179 Ga0123357_100931792 295
138 3300009784 Ga0123357_10098389 Ga0123357_100983892 295
139 3300009784 Ga0123357_10136366 Ga0123357_101363663 295
140 3300009784 Ga0123357_10353618 Ga0123357_103536182 295
141 3300010167 Ga0123353_10278755 Ga0123353_102787553 295
142 3300010167 Ga0123353_10447637 Ga0123353_104476372 295
143 3300010882 Ga0123354_10129489 Ga0123354_101294894 295
144 3300010882 Ga0123354_10337934 Ga0123354_103379342 295
145 3300041968 Ga0456237_0004106 Ga0456237_0004106_1126_2013 295
146 3300042600 Ga0466700_373983 Ga0466700_373983_635_1522 295
147 3300042612 Ga0466705_080473 Ga0466705_080473_98_985 295
148 3300042615 Ga0466711_230349 Ga0466711_230349_2732_3619 295
149 3300042615 Ga0466711_364247 Ga0466711_364247_228_1115 295
150 3300042617 Ga0466718_148910 Ga0466718_148910_32849_33736 295
151 3300042594 Ga0466694_346929 Ga0466694_346929_1220_2110 296
152 3300042652 Ga0466708_137817 Ga0466708_137817_131_1021 296
153 iso_pr_bacteria 2781125666 2781345948 296
154 3300009784 Ga0123357_10019092 Ga0123357_100190923 297
155 3300010167 Ga0123353_10497507 Ga0123353_104975072 297
156 3300042594 Ga0466694_153774 Ga0466694_153774_569_1462 297
157 3300042597 Ga0466699_002401 Ga0466699_002401_48746_49639 297
158 3300042597 Ga0466699_030314 Ga0466699_030314_1629_2522 297
159 3300042597 Ga0466699_051861 Ga0466699_051861_11364_12257 297
160 3300042597 Ga0466699_262886 Ga0466699_262886_1152_2045 297
161 3300042597 Ga0466699_441937 Ga0466699_441937_47_940 297
162 3300042601 Ga0466707_135155 Ga0466707_135155_1063_1956 297
163 3300042620 Ga0466728_122472 Ga0466728_122472_163_1056 297
164 3300010882 Ga0123354_10233209 Ga0123354_102332092 298
165 3300042601 Ga0466707_169883 Ga0466707_169883_1679_2575 298
166 3300042608 Ga0466721_402319 Ga0466721_402319_47_943 298
167 3300042619 Ga0466726_188013 Ga0466726_188013_375_1271 298
168 3300042593 Ga0466691_053921 Ga0466691_053921_1853_2752 299
169 3300042616 Ga0466715_116296 Ga0466715_116296_8736_9635 299
170 3300042620 Ga0466728_313247 Ga0466728_313247_224_1126 300
171 3300042609 Ga0466722_028834 Ga0466722_028834_2481_3503 301
172 3300042617 Ga0466718_119242 Ga0466718_119242_591_1499 302
173 3300010167 Ga0123353_10286172 Ga0123353_102861723 309
174 3300042590 Ga0466690_181924 Ga0466690_181924_1058_1993 311
175 3300042636 Ga0466703_025704 Ga0466703_025704_64738_65673 311

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase 181 301 0.99
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 20 178 0.98
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 18 132 0.84
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 20 110 0.72

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF14833 GO:0051287 NAD binding MF
PF03446 GO:0050661 NADP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.