Protein Family IF04514

Metagenome Isolate
241 Members
77 Samples
212 Scaffolds
657.71 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_172738|Ga0466690_172738_38325_40604
Length
759 aa
Sequence
MIDKYTADRIYNAAQIVDVVSDFVTLRKRGANYVGLCPFHSDNTPSFHVSPSKNICKCFACGEGGTSVQFIMKHEQISYYEALRYLAKKYNIEIRERELTDEEKHMQSDRESMVIINNWAQKFFASRLYEHEEGRRIAMSYFTERGFRDDIVRKFQLGYSLNKRDDLYANATEHGFNEIYLLKTGLVYKRDDGAIADRFHGRVIFPVHTLSGKVIAFGGRILGKKDKVAKYINSPESEIYHKSNELYGIYFARQAIVRADKCYLVEGYTDVISMHQTGIENVVASSGTSLTDGQIRLIHRFTNNITVLYDGDAAGIKAAIRGIDMLLAEGMNVKVVLLPEGEDPDSFARSHNSFDFTLYINEHEVDFIRFKAGLLLKEADDDPVKRINLIKEMMETIAVIPDNITRSVYIKECSHLFDGREQLLMDEVMKIRGRRSRSVQKMPGQRTSPPALSALSDSNLSASAQTTFAQPDSPSMIPAQSTSDVRTTPFPPASARTASDQMIWDGELATLTPNDYPPDVTTETKEGGAATGDITGKTETPVNNRDYKYSPFKKYESILLRYVIRYGERILFVDKKSDENGDIERLVSVAEYIQSELQKDEIEIQTPIYKRILEEAIVQSENEGFTASHYFLTHSDLEISKLATDMISSKYSLSKYFYNPEDVALKQTTLSDERQEAENEARKRXKERDQLERWVVHDIFTLKNAYIKHKIDDVNKQMREFRSDEEKVMTLLKKRMELDRTKIKLSKALGDRIVTGIGE

📊 Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.4%
Blattidae 19.5%
Kalotermitidae 18.2%
Unclassified 15.6%
Rhinotermitidae 6.5%
Armadillidiidae 5.2%
Termopsidae 3.9%
Passalidae 2.6%
Hydrophilidae 2.6%
Hodotermitidae 1.3%
Tenebrionidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2922326829 Bacteroides sp. 224 Isolate Blattidae
2 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
3 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
4 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
5 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
6 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
7 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
23 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
24 3004667792 Bacteroides sp. 519 Isolate Blattidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
32 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
33 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
34 3004672520 Bacteroides sp. 51 Isolate Blattidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
37 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
38 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 2920168565 Paludibacter sp. 221 Isolate Blattidae
43 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
48 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
49 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
54 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
59 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
60 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
63 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
64 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
65 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
66 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
67 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
68 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
69 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
70 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
71 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
72 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
73 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
74 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
75 3004677695 Bacteroides sp. 214 Isolate Blattidae
76 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
77 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_358603 3300042612 Bacteria 26821
2 Ga0466733_032742 3300042659 Unclassified 6534
3 Ga0466733_098295 3300042659 Bacteria 47070
4 Ga0466733_181390 3300042659 Bacteria 5500
5 Ga0562377_0004 3300056842 Bacteria 3525959
6 Ga0466715_028764 3300042616 Bacteria 6954
7 Ga0466715_222450 3300042616 Bacteria 11588
8 Ga0466715_542695 3300042616 Bacteria 15092
9 Ga0466728_057042 3300042620 Bacteria 28719
10 Ga0466728_234918 3300042620 Bacteria 4366
11 Ga0466728_333993 3300042620 Bacteria 5579
12 Ga0123353_10073987 3300010167 Bacteria 5477
13 Ga0160445_100097 3300012847 Bacteria 88551
14 Ga0466690_238245 3300042590 Bacteria 6928
15 Ga0466691_034693 3300042593 Bacteria 6170
16 Ga0466691_035670 3300042593 Bacteria 11664
17 Ga0466691_058338 3300042593 Bacteria 8322
18 Ga0466691_081545 3300042593 Bacteria 5632
19 Ga0466696_201817 3300042596 Bacteria 41274
20 Ga0466706_023757 3300042599 Bacteria 27793
21 Ga0466713_060328 3300042602 Bacteria 119085
22 Ga0466719_450712 3300042606 Bacteria 11900
23 Ga0466722_021127 3300042609 Bacteria 2767
24 Ga0466722_068382 3300042609 Bacteria 3054
25 Ga0466722_088281 3300042609 Bacteria 7425
26 Ga0466735_013877 3300042624 Bacteria 4258
27 Ga0466703_335341 3300042636 Bacteria 10091
28 Ga0466704_065433 3300042643 Bacteria 13281
29 Ga0466704_153119 3300042643 Bacteria 6789
30 Ga0466704_343809 3300042643 Bacteria 5884
31 Ga0466708_061761 3300042652 Bacteria 24390
32 2227444694 2225789004 Bacteria 5467
33 Ga0466732_007018 3300042656 Bacteria 6125
34 Ga0466715_090798 3300042616 Bacteria 3502
35 Ga0466723_367142 3300042618 Bacteria 7612
36 Ga0123357_10126919 3300009784 Bacteria 3192
37 Ga0123353_10061083 3300010167 Bacteria 6043
38 Ga0123354_10002434 3300010882 Bacteria 24588
39 Ga0466690_208472 3300042590 Bacteria 11925
40 Ga0466690_402774 3300042590 Bacteria 11069
41 Ga0466691_022383 3300042593 Bacteria 23421
42 Ga0466696_181576 3300042596 Bacteria 6528
43 Ga0466706_053989 3300042599 Bacteria 17416
44 Ga0466706_140857 3300042599 Bacteria 123527
45 Ga0466707_361813 3300042601 Bacteria 12501
46 Ga0466713_058807 3300042602 Bacteria 13735
47 Ga0466716_086550 3300042605 Bacteria 19403
48 Ga0466722_080343 3300042609 Bacteria 16839
49 Ga0466697_011496 3300042611 Bacteria 51969
50 Ga0466735_083854 3300042624 Bacteria 2862
51 Ga0466709_140267 3300042648 Bacteria 28990
52 IMNBL1DRAFT_c0010391 3300000062 Bacteria 4463
53 IMNBL1DRAFT_c0016795 3300000062 Bacteria 3114
54 Ga0466710_004099 3300042613 Bacteria 12802
55 Ga0466711_040127 3300042615 Bacteria 5853
56 Ga0466711_043069 3300042615 Bacteria 11918
57 Ga0466711_347073 3300042615 Bacteria 35232
58 Ga0466728_071543 3300042620 Bacteria 7329
59 Ga0123354_10004434 3300010882 Bacteria 19900
60 Ga0466657_038921 3300042582 Bacteria 11436
61 Ga0466696_077461 3300042596 Bacteria 10279
62 Ga0466706_053146 3300042599 Bacteria 5517
63 Ga0466706_055172 3300042599 Bacteria 72109
64 Ga0466707_010232 3300042601 Bacteria 5492
65 Ga0466707_185441 3300042601 Bacteria 8669
66 Ga0466707_192374 3300042601 Bacteria 3221
67 Ga0466713_129617 3300042602 Bacteria 20656
68 Ga0466714_155925 3300042603 Bacteria 12391
69 Ga0466719_222230 3300042606 Bacteria 4142
70 Ga0466719_475113 3300042606 Bacteria 6093
71 Ga0466721_253481 3300042608 Bacteria 27977
72 Ga0466722_113613 3300042609 Bacteria 129604
73 Ga0466729_273173 3300042621 Bacteria 5065
74 Ga0466703_199067 3300042636 Bacteria 3831
75 Ga0466709_245877 3300042648 Bacteria 9500
76 Ga0466724_57528 3300042649 Bacteria 5576
77 Ga0466727_259735 3300042655 Bacteria 15797
78 JGI24702J35022_10002964 3300002462 Bacteria 10272
79 JGI24702J35022_10003669 3300002462 Bacteria 9239
80 JGI24705J35276_12224540 3300002504 Bacteria 2621
81 Ga0123357_10000662 3300009784 Bacteria 34422
82 Ga0466697_163544 3300042611 Bacteria 8660
83 Ga0466711_069341 3300042615 Bacteria 69315
84 Ga0466715_240118 3300042616 Bacteria 29584
85 Ga0466715_548749 3300042616 Bacteria 16600
86 Ga0466723_057399 3300042618 Bacteria 11577
87 Ga0466728_166131 3300042620 Bacteria 8079
88 Ga0123356_10066955 3300010049 Bacteria 3363
89 Ga0123353_10111532 3300010167 Bacteria 4405
90 Ga0160433_100181 3300012846 Bacteria 51962
91 Ga0466696_324178 3300042596 Bacteria 4116
92 Ga0466696_475058 3300042596 Bacteria 5985
93 Ga0466707_377635 3300042601 Bacteria 12151
94 Ga0466713_119805 3300042602 Bacteria 79435
95 Ga0466719_055757 3300042606 Bacteria 33722
96 Ga0466722_107967 3300042609 Bacteria 4831
97 Ga0466735_179643 3300042624 Bacteria 2569
98 Ga0466704_257824 3300042643 Bacteria 23792
99 Ga0466725_141888 3300042654 Bacteria 11341
100 Ga0466727_153723 3300042655 Bacteria 2939
101 Ga0068305_10010856 3300005083 Bacteria 14545
102 Ga0466705_004413 3300042612 Bacteria 6122
103 Ga0466733_110450 3300042659 Bacteria 40709
104 Ga0466715_009406 3300042616 Bacteria 67720
105 Ga0466715_117721 3300042616 Bacteria 5545
106 Ga0466715_125413 3300042616 Bacteria 7398
107 Ga0466715_265152 3300042616 Bacteria 6027
108 Ga0466715_304466 3300042616 Bacteria 8317
109 Ga0466723_047670 3300042618 Bacteria 16534
110 Ga0160469_101296 3300012824 Unclassified 7055
111 Ga0160445_100403 3300012847 Bacteria 23773
112 Ga0466690_058719 3300042590 Bacteria 19075
113 Ga0466690_172738 3300042590 Bacteria 57212
114 Ga0466690_213399 3300042590 Bacteria 31259
115 Ga0466691_091359 3300042593 Bacteria 169365
116 Ga0466701_047675 3300042598 Bacteria 4166
117 Ga0466706_081386 3300042599 Bacteria 4301
118 Ga0466706_105640 3300042599 Bacteria 39915
119 Ga0466713_038044 3300042602 Bacteria 17226
120 Ga0466713_077466 3300042602 Bacteria 18852
121 Ga0466713_082368 3300042602 Bacteria 6872
122 Ga0466714_015825 3300042603 Bacteria 102725
123 Ga0466717_072598 3300042604 Bacteria 3923
124 Ga0466716_102225 3300042605 Bacteria 13051
125 Ga0466729_253528 3300042621 Bacteria 21930
126 Ga0466735_039223 3300042624 Bacteria 15993
127 Ga0466735_093862 3300042624 Bacteria 8309
128 Ga0466735_121061 3300042624 Bacteria 3415
129 Ga0466735_194557 3300042624 Bacteria 3601
130 Ga0466730_057655 3300042625 Bacteria 4426
131 Ga0466703_314483 3300042636 Bacteria 6345
132 Ga0466703_369160 3300042636 Bacteria 28465
133 Ga0466704_254192 3300042643 Bacteria 18084
134 Ga0466709_069983 3300042648 Bacteria 5831
135 Ga0466727_108007 3300042655 Bacteria 8191
136 2227524636 2225789004 Bacteria 16862
137 IMNBL1DRAFT_c0008777 3300000062 Bacteria 5098
138 Ga0068305_10007593 3300005083 Bacteria 80483
139 Ga0068305_10016637 3300005083 Bacteria 21059
140 Ga0466705_046808 3300042612 Bacteria 25523
141 Ga0466726_233725 3300042619 Bacteria 3096
142 Ga0466726_271290 3300042619 Bacteria 6858
143 Ga0466726_371181 3300042619 Bacteria 11544
144 Ga0123353_10000499 3300010167 Bacteria 48625
145 Ga0160468_100065 3300012819 Bacteria 140978
146 Ga0466690_046586 3300042590 Bacteria 8503
147 Ga0466696_054357 3300042596 Bacteria 37826
148 Ga0466706_127995 3300042599 Bacteria 4829
149 Ga0466706_192891 3300042599 Bacteria 26478
150 Ga0466707_131171 3300042601 Bacteria 11165
151 Ga0466713_019827 3300042602 Bacteria 4839
152 Ga0466713_102508 3300042602 Unclassified 8446
153 Ga0466713_118123 3300042602 Bacteria 66356
154 Ga0466722_111299 3300042609 Bacteria 5447
155 Ga0466729_247937 3300042621 Bacteria 4333
156 Ga0466703_411030 3300042636 Bacteria 3837
157 Ga0466704_231510 3300042643 Bacteria 12191
158 Ga0466727_036767 3300042655 Bacteria 15833
159 Ga0466727_301207 3300042655 Bacteria 13153
160 2227607943 2225789004 Bacteria 12222
161 IMNBL1DRAFT_c0000384 3300000062 Bacteria 37809
162 Ga0123357_10001146 3300009784 Bacteria 27559
163 Ga0466733_070989 3300042659 Bacteria 25252
164 Ga0466733_211287 3300042659 Bacteria 6139
165 Ga0466705_490256 3300042612 Bacteria 7493
166 Ga0466715_153096 3300042616 Bacteria 36493
167 Ga0466723_013868 3300042618 Bacteria 21533
168 Ga0466723_202271 3300042618 Bacteria 31309
169 Ga0466728_174203 3300042620 Bacteria 15013
170 Ga0123357_10145625 3300009784 Bacteria 2895
171 Ga0466691_007919 3300042593 Bacteria 7420
172 Ga0466696_035475 3300042596 Bacteria 23464
173 Ga0466696_192499 3300042596 Bacteria 34182
174 Ga0466696_361415 3300042596 Bacteria 4063
175 Ga0466706_082742 3300042599 Bacteria 3481
176 Ga0466716_321962 3300042605 Bacteria 4896
177 Ga0466719_104556 3300042606 Bacteria 9411
178 Ga0466719_430060 3300042606 Bacteria 7034
179 Ga0466719_466076 3300042606 Bacteria 15076
180 Ga0466735_224372 3300042624 Bacteria 2365
181 Ga0466703_077722 3300042636 Bacteria 17217
182 Ga0466703_274401 3300042636 Bacteria 5528
183 Ga0466709_090691 3300042648 Bacteria 38263
184 Ga0466709_277111 3300042648 Bacteria 42015
185 Ga0466708_406465 3300042652 Bacteria 25330
186 Ga0466727_161799 3300042655 Bacteria 20199
187 Ga0466727_318785 3300042655 Bacteria 4869
188 2227275230 2225789004 Bacteria 30389
189 IMNBL1DRAFT_c0004896 3300000062 Bacteria 7857
190 JGI24702J35022_10006164 3300002462 Bacteria 6952
191 Ga0466733_064266 3300042659 Bacteria 6283
192 Ga0466710_165584 3300042613 Unclassified 7014
193 Ga0466715_307197 3300042616 Bacteria 27739
194 Ga0466715_321517 3300042616 Bacteria 3743
195 Ga0466715_458520 3300042616 Bacteria 8601
196 Ga0466723_190749 3300042618 Bacteria 41750
197 Ga0466728_257466 3300042620 Bacteria 6677
198 Ga0123357_10006139 3300009784 Bacteria 14562
199 Ga0466690_042304 3300042590 Bacteria 9883
200 Ga0466691_006250 3300042593 Bacteria 8667
201 Ga0466696_160607 3300042596 Bacteria 11793
202 Ga0466707_188687 3300042601 Bacteria 10744
203 Ga0466714_006756 3300042603 Bacteria 211810
204 Ga0466719_015462 3300042606 Bacteria 9666
205 Ga0466703_075647 3300042636 Bacteria 21491
206 Ga0466703_383067 3300042636 Bacteria 2847
207 Ga0466709_027878 3300042648 Bacteria 5136
208 Ga0466708_044096 3300042652 Bacteria 70438
209 Ga0466708_292277 3300042652 Bacteria 30652
210 IMNBL1DRAFT_c0002685 3300000062 Bacteria 12147
211 JGI24702J35022_10026185 3300002462 Bacteria 3143
212 JGI24705J35276_12238303 3300002504 Bacteria 18959

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_321962 Ga0466716_321962_3010_4827 562
2 3300042648 Ga0466709_140267 Ga0466709_140267_14910_16682 565
3 3300042616 Ga0466715_028764 Ga0466715_028764_4363_6120 585
4 3300042590 Ga0466690_213399 Ga0466690_213399_7157_8920 587
5 3300042620 Ga0466728_174203 Ga0466728_174203_8593_10356 587
6 3300042602 Ga0466713_119805 Ga0466713_119805_75902_77689 595
7 3300000062 IMNBL1DRAFT_c0008777 IMNBL1DRAFT_00087773 604
8 3300042593 Ga0466691_022383 Ga0466691_022383_949_2886 615
9 3300042612 Ga0466705_004413 Ga0466705_004413_3918_5864 615
10 3300042620 Ga0466728_057042 Ga0466728_057042_4582_6486 617
11 3300042599 Ga0466706_082742 Ga0466706_082742_1432_3390 619
12 3300042616 Ga0466715_153096 Ga0466715_153096_14162_16111 619
13 3300042636 Ga0466703_274401 Ga0466703_274401_3570_5429 619
14 3300042590 Ga0466690_046586 Ga0466690_046586_538_2514 620
15 3300042636 Ga0466703_075647 Ga0466703_075647_7207_9180 620
16 3300042659 Ga0466733_064266 Ga0466733_064266_4044_5996 621
17 3300042659 Ga0466733_181390 Ga0466733_181390_1988_3904 621
18 3300012847 Ga0160445_100097 Ga0160445_10009734 623
19 3300042618 Ga0466723_367142 Ga0466723_367142_1614_3584 623
20 3300042652 Ga0466708_406465 Ga0466708_406465_10119_12053 624
21 3300042596 Ga0466696_192499 Ga0466696_192499_3180_5129 627
22 3300012819 Ga0160468_100065 Ga0160468_10006522 628
23 3300042616 Ga0466715_009406 Ga0466715_009406_11646_13595 628
24 3300042659 Ga0466733_211287 Ga0466733_211287_2620_4581 630
25 3300000062 IMNBL1DRAFT_c0004896 IMNBL1DRAFT_00048962 632
26 3300000062 IMNBL1DRAFT_c0002685 IMNBL1DRAFT_00026857 633
27 3300042599 Ga0466706_105640 Ga0466706_105640_21425_23443 633
28 3300042655 Ga0466727_318785 Ga0466727_318785_1381_3435 633
29 3300042604 Ga0466717_072598 Ga0466717_072598_712_2694 634
30 3300042599 Ga0466706_023757 Ga0466706_023757_21773_23821 635
31 3300042609 Ga0466722_068382 Ga0466722_068382_909_2858 635
32 3300042621 Ga0466729_273173 Ga0466729_273173_1665_3680 635
33 3300042590 Ga0466690_208472 Ga0466690_208472_4969_6939 637
34 3300042601 Ga0466707_377635 Ga0466707_377635_5445_7388 638
35 3300042659 Ga0466733_110450 Ga0466733_110450_7344_9344 638
36 3300042596 Ga0466696_181576 Ga0466696_181576_4194_6272 639
37 3300042599 Ga0466706_192891 Ga0466706_192891_14534_16621 639
38 3300042602 Ga0466713_058807 Ga0466713_058807_7166_9085 639
39 3300042616 Ga0466715_321517 Ga0466715_321517_1275_3401 639
40 3300042596 Ga0466696_361415 Ga0466696_361415_1578_3590 640
41 3300042606 Ga0466719_222230 Ga0466719_222230_491_2413 640
42 3300042596 Ga0466696_475058 Ga0466696_475058_556_2484 642
43 3300042602 Ga0466713_019827 Ga0466713_019827_1750_3750 642
44 3300042602 Ga0466713_077466 Ga0466713_077466_4775_6790 642
45 3300042606 Ga0466719_475113 Ga0466719_475113_713_2704 642
46 3300042619 Ga0466726_233725 Ga0466726_233725_123_2051 642
47 3300042648 Ga0466709_245877 Ga0466709_245877_4843_6819 642
48 3300042590 Ga0466690_238245 Ga0466690_238245_4917_6848 643
49 3300042596 Ga0466696_035475 Ga0466696_035475_15087_17039 643
50 3300042606 Ga0466719_466076 Ga0466719_466076_7592_9523 643
51 3300042615 Ga0466711_043069 Ga0466711_043069_4508_6439 643
52 3300042616 Ga0466715_304466 Ga0466715_304466_5466_7397 643
53 3300042643 Ga0466704_065433 Ga0466704_065433_10166_12097 643
54 3300042648 Ga0466709_277111 Ga0466709_277111_2625_4556 643
55 3300042652 Ga0466708_061761 Ga0466708_061761_700_2631 643
56 3300042656 Ga0466732_007018 Ga0466732_007018_1372_3303 643
57 3300042590 Ga0466690_058719 Ga0466690_058719_3839_5773 644
58 3300042593 Ga0466691_058338 Ga0466691_058338_467_2401 644
59 3300042602 Ga0466713_082368 Ga0466713_082368_366_2402 644
60 3300042620 Ga0466728_333993 Ga0466728_333993_3308_5242 644
61 3300042655 Ga0466727_161799 Ga0466727_161799_231_2165 644
62 3300042593 Ga0466691_091359 Ga0466691_091359_103155_105092 645
63 3300042596 Ga0466696_077461 Ga0466696_077461_3729_5816 645
64 3300042601 Ga0466707_188687 Ga0466707_188687_8286_10268 645
65 3300042611 Ga0466697_163544 Ga0466697_163544_2851_4788 645
66 3300042620 Ga0466728_234918 Ga0466728_234918_1503_3440 645
67 3300042648 Ga0466709_069983 Ga0466709_069983_1980_3917 645
68 2225789004 2227524636 2228031375 646
69 3300042601 Ga0466707_192374 Ga0466707_192374_753_2735 646
70 3300042612 Ga0466705_358603 Ga0466705_358603_19545_21485 646
71 3300042624 Ga0466735_194557 Ga0466735_194557_736_2676 646
72 3300042603 Ga0466714_006756 Ga0466714_006756_191806_193773 647
73 3300042636 Ga0466703_411030 Ga0466703_411030_1638_3581 647
74 3300042654 Ga0466725_141888 Ga0466725_141888_7877_9898 647
75 iso_pr_bacteria 2820740053 2820740702 647
76 3300012824 Ga0160469_101296 Ga0160469_1012964 648
77 3300012846 Ga0160433_100181 Ga0160433_10018149 648
78 3300012847 Ga0160445_100403 Ga0160445_10040319 648
79 3300042593 Ga0466691_007919 Ga0466691_007919_3634_5580 648
80 3300042620 Ga0466728_071543 Ga0466728_071543_4519_6465 648
81 3300042615 Ga0466711_347073 Ga0466711_347073_9606_11555 649
82 3300042616 Ga0466715_240118 Ga0466715_240118_2451_4454 649
83 3300042648 Ga0466709_027878 Ga0466709_027878_2305_4254 649
84 iso_pr_bacteria 2820741847 2820744166 649
85 3300042606 Ga0466719_015462 Ga0466719_015462_2696_4786 650
86 3300010167 Ga0123353_10000499 Ga0123353_1000049942 651
87 3300042643 Ga0466704_153119 Ga0466704_153119_1819_3774 651
88 iso_pr_bacteria 3004677695 3004679829 651
89 3300042596 Ga0466696_324178 Ga0466696_324178_1355_3463 652
90 3300042609 Ga0466722_021127 Ga0466722_021127_521_2560 652
91 3300042624 Ga0466735_179643 Ga0466735_179643_241_2199 652
92 3300042624 Ga0466735_224372 Ga0466735_224372_92_2050 652
93 3300042643 Ga0466704_343809 Ga0466704_343809_1987_3945 652
94 3300002462 JGI24702J35022_10026185 JGI24702J35022_100261853 653
95 3300042599 Ga0466706_055172 Ga0466706_055172_7466_9490 653
96 3300042659 Ga0466733_070989 Ga0466733_070989_7452_9413 653
97 iso_pr_bacteria 2920168565 2920168884 653
98 3300010167 Ga0123353_10073987 Ga0123353_100739875 655
99 3300042599 Ga0466706_081386 Ga0466706_081386_1486_3492 655
100 3300042606 Ga0466719_450712 Ga0466719_450712_4982_7033 655
101 3300042616 Ga0466715_548749 Ga0466715_548749_3386_5353 655
102 3300042619 Ga0466726_371181 Ga0466726_371181_3693_5660 655
103 3300042636 Ga0466703_314483 Ga0466703_314483_3286_5253 655
104 3300042636 Ga0466703_369160 Ga0466703_369160_20890_22857 655
105 3300042648 Ga0466709_090691 Ga0466709_090691_5585_7552 655
106 3300042659 Ga0466733_032742 Ga0466733_032742_3585_5552 655
107 iso_pr_bacteria 3004667792 3004671700 655
108 3300042601 Ga0466707_010232 Ga0466707_010232_2791_4761 656
109 3300042612 Ga0466705_490256 Ga0466705_490256_2924_4987 656
110 3300042621 Ga0466729_253528 Ga0466729_253528_12361_14331 656
111 3300042624 Ga0466735_083854 Ga0466735_083854_22_2016 656
112 3300042636 Ga0466703_335341 Ga0466703_335341_7598_9661 656
113 3300042655 Ga0466727_259735 Ga0466727_259735_9274_11244 656
114 3300042659 Ga0466733_098295 Ga0466733_098295_227_2197 656
115 3300009784 Ga0123357_10001146 Ga0123357_1000114619 657
116 3300042609 Ga0466722_088281 Ga0466722_088281_2819_4852 657
117 3300042599 Ga0466706_053146 Ga0466706_053146_3489_5486 658
118 3300042609 Ga0466722_113613 Ga0466722_113613_69639_71711 658
119 3300042624 Ga0466735_121061 Ga0466735_121061_703_2679 658
120 iso_pr_bacteria 3004672520 3004677030 658
121 3300042603 Ga0466714_155925 Ga0466714_155925_2033_4015 660
122 3300042624 Ga0466735_093862 Ga0466735_093862_910_2907 660
123 3300042643 Ga0466704_231510 Ga0466704_231510_7508_9490 660
124 3300010167 Ga0123353_10061083 Ga0123353_100610833 661
125 3300042605 Ga0466716_086550 Ga0466716_086550_9745_12066 661
126 3300042602 Ga0466713_038044 Ga0466713_038044_14450_16495 662
127 3300042618 Ga0466723_047670 Ga0466723_047670_8047_10035 662
128 3300042625 Ga0466730_057655 Ga0466730_057655_1474_3462 662
129 3300042636 Ga0466703_383067 Ga0466703_383067_768_2822 662
130 iso_pr_bacteria 2820748953 2820750202 662
131 iso_pr_bacteria 2922326829 2922328930 662
132 iso_pr_bacteria 2940244548 2940247384 662
133 iso_pr_bacteria 2940248789 2940251249 662
134 iso_pr_bacteria 2940253009 2940255000 662
135 iso_pr_bacteria 2940257232 2940259494 662
136 3300002504 JGI24705J35276_12238303 JGI24705J35276_122383037 663
137 3300005083 Ga0068305_10007593 Ga0068305_1000759331 663
138 3300042601 Ga0466707_131171 Ga0466707_131171_4914_6905 663
139 3300042602 Ga0466713_060328 Ga0466713_060328_15304_17295 663
140 3300042603 Ga0466714_015825 Ga0466714_015825_47668_49692 663
141 3300042652 Ga0466708_044096 Ga0466708_044096_33918_35987 663
142 2225789004 2227607943 2228177911 664
143 3300010049 Ga0123356_10066955 Ga0123356_100669551 664
144 3300056842 Ga0562377_0004 Ga0562377_0004_2873759_2875753 664
145 3300005083 Ga0068305_10010856 Ga0068305_100108568 665
146 3300042596 Ga0466696_160607 Ga0466696_160607_8340_10376 665
147 3300042602 Ga0466713_102508 Ga0466713_102508_5480_7477 665
148 3300042602 Ga0466713_118123 Ga0466713_118123_38101_40098 665
149 3300042606 Ga0466719_430060 Ga0466719_430060_2531_4543 665
150 3300042655 Ga0466727_036767 Ga0466727_036767_10866_12938 665
151 iso_pr_bacteria 8100166142 8100167719 665
152 3300005083 Ga0068305_10016637 Ga0068305_1001663712 666
153 3300042608 Ga0466721_253481 Ga0466721_253481_2894_4894 666
154 iso_pr_bacteria 2820757377 2820757395 666
155 iso_pr_bacteria 2873600114 2873601959 666
156 iso_pr_bacteria 2873610414 2873612324 666
157 iso_pr_bacteria 2910942425 2910944978 666
158 iso_pr_bacteria 2910959314 2910961956 666
159 3300042616 Ga0466715_265152 Ga0466715_265152_3772_5799 667
160 3300042624 Ga0466735_039223 Ga0466735_039223_10625_12628 667
161 3300000062 IMNBL1DRAFT_c0000384 IMNBL1DRAFT_00003847 668
162 3300042616 Ga0466715_117721 Ga0466715_117721_356_2497 668
163 3300042649 Ga0466724_57528 Ga0466724_57528_254_2260 668
164 3300042609 Ga0466722_080343 Ga0466722_080343_4024_6033 669
165 3300042609 Ga0466722_107967 Ga0466722_107967_1036_3048 670
166 3300042616 Ga0466715_458520 Ga0466715_458520_5258_7321 670
167 3300042655 Ga0466727_153723 Ga0466727_153723_758_2836 670
168 iso_pr_bacteria 2695420317 2695483336 670
169 iso_pr_bacteria 8100157865 8100158839 670
170 3300042606 Ga0466719_055757 Ga0466719_055757_22981_25038 671
171 3300042615 Ga0466711_069341 Ga0466711_069341_48444_50480 671
172 3300042616 Ga0466715_307197 Ga0466715_307197_8743_10758 671
173 3300042619 Ga0466726_271290 Ga0466726_271290_3418_5466 671
174 3300042620 Ga0466728_166131 Ga0466728_166131_2428_4443 671
175 3300002504 JGI24705J35276_12224540 JGI24705J35276_122245402 672
176 3300010882 Ga0123354_10002434 Ga0123354_1000243420 672
177 3300042593 Ga0466691_035670 Ga0466691_035670_7591_9609 672
178 3300042598 Ga0466701_047675 Ga0466701_047675_1481_3499 672
179 3300042618 Ga0466723_013868 Ga0466723_013868_373_2391 672
180 3300042624 Ga0466735_013877 Ga0466735_013877_719_2737 672
181 3300009784 Ga0123357_10000662 Ga0123357_1000066211 673
182 3300009784 Ga0123357_10006139 Ga0123357_100061398 673
183 3300042616 Ga0466715_222450 Ga0466715_222450_5760_7781 673
184 3300042620 Ga0466728_257466 Ga0466728_257466_2240_4384 673
185 3300042636 Ga0466703_077722 Ga0466703_077722_642_2711 673
186 3300042616 Ga0466715_125413 Ga0466715_125413_4522_6546 674
187 3300042621 Ga0466729_247937 Ga0466729_247937_1205_3268 674
188 3300042655 Ga0466727_301207 Ga0466727_301207_4925_6973 674
189 iso_pr_bacteria 2695420931 2698111023 674
190 3300042616 Ga0466715_090798 Ga0466715_090798_211_2274 675
191 3300042636 Ga0466703_199067 Ga0466703_199067_1179_3311 675
192 iso_pr_bacteria 2820767225 2820768024 675
193 iso_pr_bacteria 2820772500 2820773828 675
194 3300010167 Ga0123353_10111532 Ga0123353_101115322 676
195 3300010882 Ga0123354_10004434 Ga0123354_100044346 676
196 3300042590 Ga0466690_042304 Ga0466690_042304_4301_6391 676
197 3300042611 Ga0466697_011496 Ga0466697_011496_48497_50527 676
198 3300042613 Ga0466710_165584 Ga0466710_165584_2863_4893 676
199 iso_pr_bacteria 2910926975 2910928230 676
200 3300042606 Ga0466719_104556 Ga0466719_104556_5343_7412 677
201 iso_pr_bacteria 2609459943 2610740147 677
202 iso_pr_bacteria 2830041218 2830041543 677
203 iso_pr_bacteria 2940216256 2940217281 677
204 3300042601 Ga0466707_185441 Ga0466707_185441_3516_5552 678
205 3300042601 Ga0466707_361813 Ga0466707_361813_6502_8538 678
206 3300042615 Ga0466711_040127 Ga0466711_040127_3372_5450 678
207 3300002462 JGI24702J35022_10003669 JGI24702J35022_100036694 679
208 3300042582 Ga0466657_038921 Ga0466657_038921_2155_4194 679
209 3300042599 Ga0466706_053989 Ga0466706_053989_2961_5066 679
210 3300042593 Ga0466691_006250 Ga0466691_006250_1186_3228 680
211 3300042593 Ga0466691_081545 Ga0466691_081545_2087_4177 680
212 3300042599 Ga0466706_140857 Ga0466706_140857_43245_45287 680
213 3300000062 IMNBL1DRAFT_c0016795 IMNBL1DRAFT_00167952 681
214 3300009784 Ga0123357_10145625 Ga0123357_101456252 681
215 2225789004 2227275230 2227725843 682
216 3300000062 IMNBL1DRAFT_c0010391 IMNBL1DRAFT_00103913 682
217 3300042652 Ga0466708_292277 Ga0466708_292277_15035_17131 682
218 3300042590 Ga0466690_402774 Ga0466690_402774_1461_3518 685
219 3300002462 JGI24702J35022_10006164 JGI24702J35022_100061643 686
220 3300002462 JGI24702J35022_10002964 JGI24702J35022_100029643 687
221 3300042643 Ga0466704_257824 Ga0466704_257824_11287_13350 687
222 3300042618 Ga0466723_202271 Ga0466723_202271_7348_9414 688
223 3300042602 Ga0466713_129617 Ga0466713_129617_10791_12908 689
224 3300042612 Ga0466705_046808 Ga0466705_046808_21493_23562 689
225 3300042596 Ga0466696_054357 Ga0466696_054357_18329_20422 690
226 3300042605 Ga0466716_102225 Ga0466716_102225_343_2487 690
227 3300042613 Ga0466710_004099 Ga0466710_004099_4673_6745 690
228 3300042643 Ga0466704_254192 Ga0466704_254192_4023_6095 690
229 iso_pr_bacteria 2940193328 2940193474 690
230 iso_pr_bacteria 2940336608 2940336753 690
231 3300042609 Ga0466722_111299 Ga0466722_111299_1614_3725 691
232 3300009784 Ga0123357_10126919 Ga0123357_101269192 692
233 3300042593 Ga0466691_034693 Ga0466691_034693_3872_5995 693
234 3300042599 Ga0466706_127995 Ga0466706_127995_964_3060 693
235 2225789004 2227444694 2227882710 696
236 3300042616 Ga0466715_542695 Ga0466715_542695_4368_6458 696
237 3300042655 Ga0466727_108007 Ga0466727_108007_3576_5675 699
238 3300042618 Ga0466723_057399 Ga0466723_057399_2698_4863 703
239 3300042618 Ga0466723_190749 Ga0466723_190749_35273_37558 712
240 3300042596 Ga0466696_201817 Ga0466696_201817_36915_39437 752
241 3300042590 Ga0466690_172738 Ga0466690_172738_38325_40604 759

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13155 Toprim_2 Toprim-like 263 347 0.98
PF13662 Toprim_4 Toprim domain 262 336 0.95
PF01807 zf-CHC2 CHC2 zinc finger 5 96 0.95
PF08275 DNAG_N DNA primase catalytic core, N-terminal domain 123 252 0.92
PF01751 Toprim Toprim domain 263 333 0.88
PF10410 DnaB_bind DnaB-helicase binding domain of primase 375 418 0.88
PF13362 Toprim_3 Toprim domain 263 351 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF10410 GO:0016779 nucleotidyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.