Protein Family IF04508

Metagenome Isolate
151 Members
34 Samples
147 Scaffolds
448.05 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_152887|Ga0466690_152887_3916_5430
Length
504 aa
Sequence
MRPNSEMETVLPVSSKALFRSNAACSCRRRGAVFPCIEFQAHPCYSASLKETSMIVMKFGGSSVANAERIRRVAEIVKPRIAEKPALVLSAMGDTTDYLLEAASAALQGGAVSIERIVDLHQGAMAELGLGDRAAAELESLVGELRSLLTGIALIKELSDKTRDYLVSFGERLSVRLVAAYLNSIGVQARAMDAWDAGLLSDSNFSFAELDEDSWNRVPLALSPLIEEGTLPVITGFIAKDRQGNITTLGRGGSDLSATFIAAAMGAAEVQVWKDVDGILTADPRLVKNARPVETVSYEEAAELAYFGAQVLHPRAMQPCIKTGAVVRVKNSYNPQAEGTRIIARVDKKAGPVRAITSRKNVTLVDIVSTRMVGQYGFLAEVFAAFANHKLSVDMVATSEVSISLTLDAAHDLEKLRRDLSKIADVEIKTGKAIVTIIGDVRRSSEILQRAFGTCVLLGIQVQMISQGASKVNISFIVDGSQAGEVVAALHQCFFEPLNEEALG

πŸ“Š Sample Types

Isolate 2.6%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 42.4%
Termitidae 21.2%
Unclassified 18.2%
Termopsidae 9.1%
Rhinotermitidae 6.1%
Blaberidae 3.0%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2772190975 Treponema sp. RmG30 Isolate Blaberidae
12 650716102 Treponema primitia ZAS-2 Isolate Unclassified
13 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_018861 3300042602 Bacteria 22862
2 Ga0466716_347127 3300042605 Bacteria 15723
3 Ga0466711_001519 3300042615 Bacteria 36988
4 Ga0466711_233862 3300042615 Bacteria 2894
5 Ga0466715_106710 3300042616 Bacteria 8951
6 Ga0466715_355095 3300042616 Bacteria 1755
7 Ga0466723_173837 3300042618 Bacteria 38157
8 Ga0466726_053327 3300042619 Bacteria 10018
9 Ga0466726_490200 3300042619 Bacteria 14288
10 Ga0466728_103025 3300042620 Bacteria 2497
11 Ga0466729_049644 3300042621 Bacteria 1722
12 Ga0466729_095525 3300042621 Bacteria 3433
13 Ga0466691_013172 3300042593 Bacteria 11157
14 Ga0466691_150659 3300042593 Bacteria 5832
15 Ga0466695_405588 3300042595 Bacteria 3656
16 Ga0466696_103818 3300042596 Bacteria 13702
17 Ga0466735_084570 3300042624 Bacteria 4005
18 Ga0466703_135693 3300042636 Bacteria 3728
19 Ga0466709_127328 3300042648 Bacteria 2990
20 Ga0466727_106716 3300042655 Bacteria 2293
21 Ga0466727_230491 3300042655 Bacteria 44965
22 AustNasuHG_c1006958 3300000089 Bacteria 4030
23 Ga0466722_105240 3300042609 Bacteria 1894
24 Ga0466722_179064 3300042609 Bacteria 7349
25 Ga0466715_154919 3300042616 Bacteria 14311
26 Ga0466723_088657 3300042618 Bacteria 4001
27 Ga0466723_194702 3300042618 Bacteria 2682
28 Ga0466726_058806 3300042619 Bacteria 5585
29 Ga0466694_048108 3300042594 Bacteria 2481
30 Ga0466696_018317 3300042596 Unclassified 14126
31 Ga0466696_076705 3300042596 Bacteria 14008
32 Ga0466704_086443 3300042643 Bacteria 4757
33 Ga0466704_312033 3300042643 Bacteria 7358
34 Ga0466709_259608 3300042648 Bacteria 8752
35 Ga0466708_013013 3300042652 Bacteria 5360
36 Ga0466727_172398 3300042655 Bacteria 2572
37 Ga0466705_138823 3300042612 Bacteria 3705
38 Ga0466705_366553 3300042612 Bacteria 7041
39 Ga0466733_008849 3300042659 Bacteria 1464
40 Ga0466705_488971 3300042612 Bacteria 7617
41 Ga0466723_304311 3300042618 Bacteria 3892
42 Ga0466726_356043 3300042619 Archaea 3264
43 Ga0466726_469940 3300042619 Bacteria 3157
44 Ga0466728_063252 3300042620 Bacteria 5206
45 Ga0466728_171590 3300042620 Bacteria 2740
46 Ga0466690_152887 3300042590 Bacteria 11754
47 Ga0466696_113986 3300042596 Bacteria 2551
48 Ga0466704_150223 3300042643 Bacteria 17277
49 Ga0466704_347788 3300042643 Bacteria 1563
50 Ga0466727_321693 3300042655 Bacteria 2642
51 Ga0466705_351091 3300042612 Bacteria 6034
52 Ga0466707_396803 3300042601 Bacteria 1670
53 Ga0466716_139895 3300042605 Bacteria 3087
54 Ga0466719_048724 3300042606 Bacteria 3149
55 Ga0466719_094719 3300042606 Bacteria 35699
56 Ga0466719_156740 3300042606 Bacteria 21000
57 Ga0466719_251791 3300042606 Bacteria 13678
58 Ga0466705_441272 3300042612 Bacteria 3253
59 Ga0466715_099637 3300042616 Bacteria 16149
60 Ga0466723_358413 3300042618 Bacteria 6322
61 Ga0466728_020618 3300042620 Bacteria 3906
62 Ga0466729_188114 3300042621 Bacteria 8970
63 Ga0123355_10099297 3300009826 Unclassified 4588
64 Ga0466690_184731 3300042590 Bacteria 8122
65 Ga0466691_050524 3300042593 Bacteria 6730
66 Ga0466691_109239 3300042593 Bacteria 13044
67 Ga0466696_252281 3300042596 Bacteria 2991
68 Ga0466703_337031 3300042636 Bacteria 4170
69 Ga0466704_361173 3300042643 Bacteria 24999
70 Ga0466704_379441 3300042643 Bacteria 22236
71 Ga0466727_214161 3300042655 Bacteria 1441
72 Ga0466705_005917 3300042612 Unclassified 4214
73 Ga0466716_027907 3300042605 Bacteria 11091
74 Ga0466716_497274 3300042605 Bacteria 27635
75 Ga0466722_156350 3300042609 Bacteria 15490
76 Ga0466711_278536 3300042615 Bacteria 2764
77 Ga0466711_509250 3300042615 Bacteria 7534
78 Ga0466723_090103 3300042618 Bacteria 1503
79 Ga0466728_356934 3300042620 Bacteria 7862
80 Ga0123355_10270537 3300009826 Bacteria 2361
81 Ga0264413_128997 3300024493 Bacteria 4807
82 Ga0466690_011760 3300042590 Bacteria 15760
83 Ga0466690_220746 3300042590 Bacteria 1885
84 Ga0466690_225351 3300042590 Bacteria 11622
85 Ga0466691_073252 3300042593 Bacteria 4393
86 Ga0466691_102279 3300042593 Bacteria 4705
87 Ga0466691_106456 3300042593 Bacteria 7416
88 Ga0466735_035377 3300042624 Bacteria 6944
89 Ga0466703_140860 3300042636 Bacteria 5582
90 Ga0466703_302811 3300042636 Bacteria 16476
91 Ga0466704_059873 3300042643 Bacteria 9066
92 Ga0466704_090443 3300042643 Bacteria 2079
93 Ga0466709_061036 3300042648 Bacteria 13570
94 Ga0466708_218025 3300042652 Bacteria 18464
95 Ga0072940_1068665 3300005200 Bacteria 2417
96 Ga0466705_162796 3300042612 Unclassified 3860
97 Ga0466707_173865 3300042601 Bacteria 1640
98 Ga0466715_098690 3300042616 Bacteria 13525
99 Ga0466723_006517 3300042618 Bacteria 14855
100 Ga0466723_096020 3300042618 Bacteria 11191
101 Ga0466726_350598 3300042619 Bacteria 2872
102 Ga0466728_137750 3300042620 Bacteria 3576
103 Ga0466691_013939 3300042593 Bacteria 6967
104 Ga0466691_025299 3300042593 Bacteria 2691
105 Ga0466691_120345 3300042593 Bacteria 13092
106 Ga0466691_130705 3300042593 Bacteria 12220
107 Ga0466696_082242 3300042596 Bacteria 11475
108 Ga0466703_027550 3300042636 Bacteria 11089
109 Ga0466709_234621 3300042648 Bacteria 8009
110 Ga0466708_109511 3300042652 Bacteria 32313
111 Ga0466708_169094 3300042652 Bacteria 3622
112 Ga0466708_206800 3300042652 Bacteria 16211
113 Ga0466708_322281 3300042652 Bacteria 15490
114 Ga0466708_464475 3300042652 Bacteria 69222
115 Ga0068305_10032411 3300005083 Bacteria 7707
116 Ga0466705_262070 3300042612 Bacteria 3045
117 Ga0466733_004926 3300042659 Bacteria 4517
118 Ga0466733_165470 3300042659 Bacteria 3230
119 Ga0466716_066787 3300042605 Bacteria 4976
120 Ga0466716_247787 3300042605 Bacteria 10104
121 Ga0466719_276867 3300042606 Bacteria 13939
122 Ga0466722_191203 3300042609 Bacteria 5411
123 Ga0466722_200719 3300042609 Bacteria 11500
124 Ga0466715_086582 3300042616 Bacteria 6630
125 Ga0466715_174577 3300042616 Bacteria 2974
126 Ga0466715_270970 3300042616 Bacteria 3036
127 Ga0466718_054226 3300042617 Bacteria 1592
128 Ga0466728_078215 3300042620 Bacteria 4596
129 Ga0466690_004849 3300042590 Bacteria 3454
130 Ga0466691_023784 3300042593 Bacteria 15484
131 Ga0466696_072579 3300042596 Bacteria 12290
132 Ga0466703_195089 3300042636 Bacteria 2742
133 Ga0466708_023393 3300042652 Bacteria 3961
134 Ga0466727_259956 3300042655 Bacteria 4233
135 Ga0466727_327788 3300042655 Bacteria 14506
136 Ga0466705_180803 3300042612 Bacteria 12619
137 Ga0466723_160805 3300042618 Bacteria 4966
138 Ga0466723_171803 3300042618 Bacteria 59143
139 Ga0466723_196144 3300042618 Bacteria 3170
140 Ga0466723_298435 3300042618 Bacteria 4343
141 Ga0466690_040677 3300042590 Bacteria 3104
142 Ga0466690_275648 3300042590 Bacteria 3997
143 Ga0466703_065803 3300042636 Bacteria 8199
144 Ga0466703_173156 3300042636 Bacteria 10084
145 Ga0466703_265854 3300042636 Bacteria 5449
146 Ga0466704_448806 3300042643 Unclassified 7611
147 Ga0466709_101846 3300042648 Bacteria 4145

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_276867 Ga0466719_276867_8976_10202 408
2 3300042609 Ga0466722_105240 Ga0466722_105240_650_1879 409
3 3300042612 Ga0466705_366553 Ga0466705_366553_5683_6915 410
4 3300042593 Ga0466691_023784 Ga0466691_023784_1672_2907 411
5 3300042593 Ga0466691_073252 Ga0466691_073252_1634_2881 415
6 3300042590 Ga0466690_004849 Ga0466690_004849_332_1588 418
7 3300042593 Ga0466691_150659 Ga0466691_150659_2599_3855 418
8 3300042659 Ga0466733_004926 Ga0466733_004926_2634_3974 421
9 3300042593 Ga0466691_106456 Ga0466691_106456_4319_5647 422
10 3300042590 Ga0466690_275648 Ga0466690_275648_84_1355 423
11 3300042596 Ga0466696_252281 Ga0466696_252281_1319_2671 425
12 3300042619 Ga0466726_058806 Ga0466726_058806_1152_2483 427
13 3300042643 Ga0466704_347788 Ga0466704_347788_169_1500 429
14 3300042616 Ga0466715_106710 Ga0466715_106710_1569_2924 434
15 3300042619 Ga0466726_356043 Ga0466726_356043_203_1507 434
16 3300042636 Ga0466703_135693 Ga0466703_135693_16_1323 435
17 3300042618 Ga0466723_090103 Ga0466723_090103_17_1405 436
18 3300042612 Ga0466705_180803 Ga0466705_180803_1068_2384 438
19 3300042602 Ga0466713_018861 Ga0466713_018861_21514_22833 439
20 3300042636 Ga0466703_027550 Ga0466703_027550_3919_5238 439
21 3300024493 Ga0264413_128997 Ga0264413_1289972 440
22 3300042593 Ga0466691_013939 Ga0466691_013939_3623_4963 440
23 3300042620 Ga0466728_137750 Ga0466728_137750_837_2201 441
24 3300042643 Ga0466704_448806 Ga0466704_448806_2298_3623 441
25 3300005200 Ga0072940_1068665 Ga0072940_10686653 442
26 3300042596 Ga0466696_018317 Ga0466696_018317_2013_3341 442
27 3300042616 Ga0466715_355095 Ga0466715_355095_279_1607 442
28 3300042619 Ga0466726_469940 Ga0466726_469940_1599_2927 442
29 3300042620 Ga0466728_171590 Ga0466728_171590_1347_2714 442
30 3300042621 Ga0466729_188114 Ga0466729_188114_2597_3925 442
31 3300042648 Ga0466709_234621 Ga0466709_234621_6280_7641 442
32 3300042648 Ga0466709_259608 Ga0466709_259608_4697_6025 442
33 3300009826 Ga0123355_10270537 Ga0123355_102705372 443
34 3300042590 Ga0466690_011760 Ga0466690_011760_9029_10360 443
35 3300042590 Ga0466690_225351 Ga0466690_225351_2497_3828 443
36 3300042594 Ga0466694_048108 Ga0466694_048108_252_1583 443
37 3300042615 Ga0466711_509250 Ga0466711_509250_1767_3098 443
38 3300042619 Ga0466726_350598 Ga0466726_350598_1390_2721 443
39 3300042636 Ga0466703_195089 Ga0466703_195089_1344_2675 443
40 3300042655 Ga0466727_172398 Ga0466727_172398_1008_2339 443
41 3300042596 Ga0466696_072579 Ga0466696_072579_9224_10630 444
42 3300042618 Ga0466723_358413 Ga0466723_358413_795_2162 444
43 3300042590 Ga0466690_220746 Ga0466690_220746_411_1748 445
44 3300042609 Ga0466722_191203 Ga0466722_191203_2290_3627 445
45 3300042612 Ga0466705_005917 Ga0466705_005917_2049_3386 445
46 3300042618 Ga0466723_173837 Ga0466723_173837_34759_36096 445
47 3300042618 Ga0466723_298435 Ga0466723_298435_2699_4036 445
48 3300042643 Ga0466704_312033 Ga0466704_312033_2748_4085 445
49 3300042593 Ga0466691_013172 Ga0466691_013172_7537_8877 446
50 3300042596 Ga0466696_103818 Ga0466696_103818_7318_8658 446
51 3300042601 Ga0466707_173865 Ga0466707_173865_253_1593 446
52 3300042605 Ga0466716_027907 Ga0466716_027907_738_2078 446
53 3300042609 Ga0466722_179064 Ga0466722_179064_5466_6806 446
54 3300042618 Ga0466723_171803 Ga0466723_171803_26087_27427 446
55 3300042618 Ga0466723_194702 Ga0466723_194702_83_1423 446
56 3300042636 Ga0466703_302811 Ga0466703_302811_9382_10722 446
57 3300042643 Ga0466704_379441 Ga0466704_379441_7580_8920 446
58 3300042648 Ga0466709_101846 Ga0466709_101846_1616_2956 446
59 iso_pr_bacteria 2781125653 2781313807 446
60 3300009826 Ga0123355_10099297 Ga0123355_100992972 447
61 3300042605 Ga0466716_497274 Ga0466716_497274_17314_18657 447
62 3300042636 Ga0466703_140860 Ga0466703_140860_1823_3166 447
63 3300042648 Ga0466709_061036 Ga0466709_061036_3320_4693 447
64 3300042659 Ga0466733_008849 Ga0466733_008849_110_1453 447
65 3300042593 Ga0466691_130705 Ga0466691_130705_7459_8805 448
66 3300042595 Ga0466695_405588 Ga0466695_405588_84_1430 448
67 3300042609 Ga0466722_200719 Ga0466722_200719_7735_9081 448
68 3300042655 Ga0466727_106716 Ga0466727_106716_666_2012 448
69 3300042655 Ga0466727_214161 Ga0466727_214161_54_1400 448
70 3300042593 Ga0466691_025299 Ga0466691_025299_1031_2380 449
71 3300042605 Ga0466716_066787 Ga0466716_066787_1144_2493 449
72 3300042612 Ga0466705_488971 Ga0466705_488971_5185_6534 449
73 3300042616 Ga0466715_099637 Ga0466715_099637_12968_14317 449
74 3300042616 Ga0466715_270970 Ga0466715_270970_256_1605 449
75 3300042618 Ga0466723_196144 Ga0466723_196144_83_1432 449
76 3300042618 Ga0466723_304311 Ga0466723_304311_1547_2896 449
77 3300042619 Ga0466726_053327 Ga0466726_053327_6390_7739 449
78 3300042620 Ga0466728_020618 Ga0466728_020618_860_2209 449
79 3300042636 Ga0466703_065803 Ga0466703_065803_5778_7127 449
80 3300042652 Ga0466708_169094 Ga0466708_169094_306_1655 449
81 3300042652 Ga0466708_464475 Ga0466708_464475_11333_12682 449
82 3300042655 Ga0466727_327788 Ga0466727_327788_9750_11099 449
83 3300000089 AustNasuHG_c1006958 AustNasuHG_10069582 450
84 3300005083 Ga0068305_10032411 Ga0068305_100324114 450
85 3300042593 Ga0466691_102279 Ga0466691_102279_2220_3572 450
86 3300042593 Ga0466691_109239 Ga0466691_109239_9265_10617 450
87 3300042605 Ga0466716_347127 Ga0466716_347127_6150_7502 450
88 3300042606 Ga0466719_048724 Ga0466719_048724_1297_2649 450
89 3300042606 Ga0466719_094719 Ga0466719_094719_23878_25230 450
90 3300042606 Ga0466719_251791 Ga0466719_251791_2449_3801 450
91 3300042609 Ga0466722_156350 Ga0466722_156350_12088_13440 450
92 3300042612 Ga0466705_162796 Ga0466705_162796_436_1788 450
93 3300042618 Ga0466723_088657 Ga0466723_088657_1514_2866 450
94 3300042620 Ga0466728_103025 Ga0466728_103025_1094_2446 450
95 3300042620 Ga0466728_356934 Ga0466728_356934_1669_3021 450
96 3300042636 Ga0466703_337031 Ga0466703_337031_1540_2892 450
97 3300042643 Ga0466704_059873 Ga0466704_059873_7694_9046 450
98 3300042643 Ga0466704_086443 Ga0466704_086443_2817_4169 450
99 3300042652 Ga0466708_206800 Ga0466708_206800_9300_10652 450
100 3300042593 Ga0466691_120345 Ga0466691_120345_2865_4220 451
101 3300042616 Ga0466715_098690 Ga0466715_098690_1290_2645 451
102 3300042618 Ga0466723_006517 Ga0466723_006517_11754_13109 451
103 3300042636 Ga0466703_265854 Ga0466703_265854_2083_3438 451
104 3300042643 Ga0466704_150223 Ga0466704_150223_1713_3068 451
105 3300042652 Ga0466708_218025 Ga0466708_218025_14021_15376 451
106 iso_pr_bacteria 650716102 650881839 451
107 3300042615 Ga0466711_278536 Ga0466711_278536_397_1755 452
108 3300042617 Ga0466718_054226 Ga0466718_054226_190_1548 452
109 3300042605 Ga0466716_247787 Ga0466716_247787_4176_5537 453
110 3300042612 Ga0466705_262070 Ga0466705_262070_929_2290 453
111 3300042620 Ga0466728_078215 Ga0466728_078215_3193_4554 453
112 3300042624 Ga0466735_084570 Ga0466735_084570_432_1793 453
113 3300042636 Ga0466703_173156 Ga0466703_173156_8442_9830 453
114 3300042648 Ga0466709_127328 Ga0466709_127328_1241_2602 453
115 3300042655 Ga0466727_321693 Ga0466727_321693_293_1654 453
116 iso_pr_bacteria 2781125690 2781428034 453
117 3300042618 Ga0466723_096020 Ga0466723_096020_4139_5503 454
118 3300042590 Ga0466690_184731 Ga0466690_184731_6179_7546 455
119 3300042596 Ga0466696_076705 Ga0466696_076705_12340_13707 455
120 3300042596 Ga0466696_113986 Ga0466696_113986_36_1403 455
121 3300042605 Ga0466716_139895 Ga0466716_139895_344_1711 455
122 3300042612 Ga0466705_138823 Ga0466705_138823_2095_3462 455
123 3300042612 Ga0466705_441272 Ga0466705_441272_92_1459 455
124 3300042615 Ga0466711_233862 Ga0466711_233862_371_1738 455
125 3300042619 Ga0466726_490200 Ga0466726_490200_733_2100 455
126 3300042621 Ga0466729_095525 Ga0466729_095525_22_1389 455
127 3300042643 Ga0466704_090443 Ga0466704_090443_138_1505 455
128 3300042590 Ga0466690_040677 Ga0466690_040677_1251_2621 456
129 3300042593 Ga0466691_050524 Ga0466691_050524_4294_5664 456
130 3300042616 Ga0466715_154919 Ga0466715_154919_4725_6095 456
131 3300042643 Ga0466704_361173 Ga0466704_361173_19483_20853 456
132 3300042655 Ga0466727_259956 Ga0466727_259956_1784_3154 456
133 3300042606 Ga0466719_156740 Ga0466719_156740_17460_18833 457
134 3300042615 Ga0466711_001519 Ga0466711_001519_30798_32171 457
135 3300042620 Ga0466728_063252 Ga0466728_063252_2468_3844 458
136 3300042655 Ga0466727_230491 Ga0466727_230491_30553_31932 459
137 3300042659 Ga0466733_165470 Ga0466733_165470_1733_3148 459
138 iso_pr_bacteria 2772190975 2773724276 460
139 3300042601 Ga0466707_396803 Ga0466707_396803_47_1465 461
140 3300042612 Ga0466705_351091 Ga0466705_351091_2905_4293 462
141 3300042618 Ga0466723_160805 Ga0466723_160805_523_1917 464
142 3300042624 Ga0466735_035377 Ga0466735_035377_980_2374 464
143 3300042621 Ga0466729_049644 Ga0466729_049644_155_1552 465
144 3300042652 Ga0466708_322281 Ga0466708_322281_7845_9293 468
145 3300042616 Ga0466715_174577 Ga0466715_174577_968_2398 476
146 3300042652 Ga0466708_109511 Ga0466708_109511_5833_7263 476
147 3300042616 Ga0466715_086582 Ga0466715_086582_547_1980 477
148 3300042652 Ga0466708_023393 Ga0466708_023393_1371_2816 481
149 3300042596 Ga0466696_082242 Ga0466696_082242_2918_4390 490
150 3300042652 Ga0466708_013013 Ga0466708_013013_3700_5172 490
151 3300042590 Ga0466690_152887 Ga0466690_152887_3916_5430 504

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22468 ACT_9 ACT domain 435 494 0.97
PF00696 AA_kinase Amino acid kinase family 54 331 0.89

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.