Protein Family IF04481

Metagenome Isolate
189 Members
63 Samples
176 Scaffolds
476.93 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_070518|Ga0466690_070518_6069_7727
Length
525 aa
Sequence
MEILPTLLYNKTDLEAMTVWFTFWEQYIPRTADFNKERALVRRDFPKIHFYDQDFVDIYDKTWVWIQDCWSTGSDKIAAGEGVKENAANEIIEGKFFSYPGSPVIHQADAVYSSFFLVYSNRIYHAHPSLDVFYSHQEPNGAIRSAYNIKTGLPELAPDNPDGLALPLFSWAEFNLYHKTANKKRIKEVIPILHKYIAWLDEFKRPNGLYEVPVAATGMATPVREGAAYPVDFNTVMAINVLYMSALADILNDKEASFQYKRQYFSLKTRINRLMWNNDDGFYYDIDKYEKQIKVKTLAGYWSLLAEIPNDDKAERIIGKLSDPAFFGSPHPFPSMAMNESAFSELGCGFNGSVYPHLTFMVIKGLERYQRWDFARECATRHLYFVLDSMSPDGNHHKGNLWEAYLPLKEGPAQWPGAADFPRSQYLTYAALSTVCLTIENVIGLLISLPRKTVDWIIPNLEIMGIENLSLKKNLITILSNKSGRGWEIHMESEKLYYFTINILGKKKKTLPIPSGKCSMLIDKL

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.3%
Unclassified 26.2%
Kalotermitidae 23.0%
Rhinotermitidae 4.9%
Termopsidae 4.9%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
37 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
41 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
44 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
45 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
53 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
54 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
55 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
56 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
60 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
61 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_024137 3300042612 Unclassified 9349
2 Ga0466705_059722 3300042612 Bacteria 11103
3 Ga0466705_199987 3300042612 Bacteria 3911
4 Ga0466722_194617 3300042609 Bacteria 10053
5 Ga0466712_033366 3300042614 Bacteria 28713
6 Ga0466715_093039 3300042616 Bacteria 4641
7 Ga0466726_394529 3300042619 Bacteria 6194
8 AustNasuHG_c1016198 3300000089 Bacteria 2499
9 Ga0466692_120629 3300042591 Bacteria 11031
10 Ga0466692_200660 3300042591 Bacteria 2783
11 Ga0466692_203028 3300042591 Bacteria 6227
12 Ga0466691_033739 3300042593 Bacteria 7786
13 Ga0466691_063934 3300042593 Bacteria 11155
14 Ga0466696_434397 3300042596 Bacteria 9417
15 Ga0466735_102914 3300042624 Bacteria 3805
16 Ga0466702_402965 3300042635 Bacteria 1605
17 Ga0466703_269294 3300042636 Bacteria 25548
18 Ga0466704_032239 3300042643 Bacteria 21487
19 Ga0466704_411953 3300042643 Bacteria 1993
20 Ga0466709_058054 3300042648 Bacteria 9911
21 Ga0466708_308305 3300042652 Bacteria 6973
22 Ga0466732_355699 3300042656 Unclassified 1977
23 Ga0466706_030503 3300042599 Bacteria 7425
24 Ga0466714_042127 3300042603 Bacteria 1797
25 Ga0466716_140743 3300042605 Bacteria 26918
26 Ga0466719_200254 3300042606 Bacteria 1385
27 Ga0466722_011447 3300042609 Bacteria 2225
28 Ga0123355_10017180 3300009826 Bacteria 11423
29 Ga0123353_10003165 3300010167 Bacteria 20693
30 Ga0123354_10124759 3300010882 Bacteria 3297
31 Ga0466712_043323 3300042614 Bacteria 3350
32 Ga0466711_170233 3300042615 Bacteria 2876
33 Ga0466723_096576 3300042618 Bacteria 15241
34 Ga0466723_150577 3300042618 Unclassified 6574
35 Ga0466726_301853 3300042619 Bacteria 9267
36 Ga0466726_380186 3300042619 Bacteria 5437
37 JGI24698J34947_10017490 3300002449 Unclassified 3884
38 JGI24695J34938_10011520 3300002450 Unclassified 4758
39 Ga0068305_10013973 3300005083 Bacteria 11658
40 Ga0072940_1022677 3300005200 Bacteria 29727
41 Ga0072941_1007748 3300005201 Bacteria 28364
42 Ga0466690_307022 3300042590 Bacteria 5406
43 Ga0466691_092461 3300042593 Bacteria 19341
44 Ga0466694_331591 3300042594 Bacteria 1888
45 Ga0466705_013264 3300042612 Bacteria 16338
46 Ga0466705_014464 3300042612 Bacteria 3982
47 Ga0466707_386180 3300042601 Bacteria 3684
48 Ga0466713_143614 3300042602 Bacteria 2026
49 Ga0123356_10005024 3300010049 Bacteria 13561
50 Ga0466715_085574 3300042616 Bacteria 8926
51 Ga0466715_308927 3300042616 Bacteria 17155
52 Ga0466723_289822 3300042618 Unclassified 4550
53 Ga0466726_034060 3300042619 Bacteria 15500
54 Ga0466728_301164 3300042620 Bacteria 3611
55 JGI24698J34947_10016497 3300002449 Bacteria 4009
56 JGI24695J34938_10000876 3300002450 Bacteria 27795
57 Ga0264413_104689 3300024493 Bacteria 4814
58 Ga0466690_000984 3300042590 Bacteria 53852
59 Ga0466692_149322 3300042591 Bacteria 5650
60 Ga0466694_005840 3300042594 Bacteria 106514
61 Ga0466731_207283 3300042622 Bacteria 10763
62 Ga0466702_364223 3300042635 Unclassified 2672
63 Ga0466703_061549 3300042636 Bacteria 5412
64 Ga0466703_080701 3300042636 Bacteria 18954
65 Ga0466704_357597 3300042643 Bacteria 27543
66 Ga0466709_008898 3300042648 Unclassified 5199
67 Ga0466709_027268 3300042648 Bacteria 4593
68 Ga0466708_159290 3300042652 Bacteria 3855
69 Ga0466708_328366 3300042652 Unclassified 8295
70 Ga0466705_106816 3300042612 Bacteria 8937
71 Ga0466720_234824 3300042607 Unclassified 3334
72 Ga0466722_072167 3300042609 Bacteria 4590
73 Ga0466712_066846 3300042614 Bacteria 4970
74 Ga0466711_030550 3300042615 Bacteria 19572
75 Ga0466715_252950 3300042616 Bacteria 3135
76 Ga0466723_193287 3300042618 Unclassified 1858
77 Ga0466726_126274 3300042619 Bacteria 7652
78 JGI24695J34938_10004610 3300002450 Bacteria 8963
79 Ga0415639_005098 3300038395 Bacteria 21971
80 Ga0466690_163825 3300042590 Unclassified 2973
81 Ga0466690_312592 3300042590 Bacteria 5875
82 Ga0466691_155881 3300042593 Bacteria 7179
83 Ga0466702_039700 3300042635 Bacteria 15948
84 Ga0466702_061677 3300042635 Bacteria 3096
85 Ga0466703_086333 3300042636 Bacteria 22187
86 Ga0466704_152278 3300042643 Bacteria 2148
87 Ga0466708_041552 3300042652 Bacteria 9503
88 Ga0466708_334476 3300042652 Bacteria 13690
89 Ga0466708_424368 3300042652 Unclassified 5442
90 Ga0466706_213807 3300042599 Bacteria 5697
91 Ga0466707_219043 3300042601 Bacteria 1651
92 Ga0123356_10000249 3300010049 Bacteria 61743
93 Ga0466705_474726 3300042612 Bacteria 17919
94 Ga0466705_498405 3300042612 Bacteria 10957
95 Ga0466712_043753 3300042614 Bacteria 23887
96 Ga0466712_091209 3300042614 Bacteria 5532
97 Ga0466711_206135 3300042615 Bacteria 18008
98 Ga0466715_378692 3300042616 Bacteria 17596
99 Ga0466723_214354 3300042618 Bacteria 13654
100 Ga0466728_447202 3300042620 Bacteria 2755
101 Ga0466690_362077 3300042590 Bacteria 1935
102 Ga0466692_164656 3300042591 Bacteria 21408
103 Ga0466693_186633 3300042592 Bacteria 79738
104 Ga0466694_202435 3300042594 Bacteria 20367
105 Ga0466694_285787 3300042594 Bacteria 38692
106 Ga0466696_152232 3300042596 Bacteria 14945
107 Ga0466696_425714 3300042596 Bacteria 23033
108 Ga0466702_076095 3300042635 Bacteria 4297
109 Ga0466702_192458 3300042635 Bacteria 4538
110 Ga0466703_185697 3300042636 Bacteria 25709
111 Ga0466704_250209 3300042643 Bacteria 34988
112 Ga0466704_366916 3300042643 Bacteria 18576
113 Ga0466709_168442 3300042648 Bacteria 10545
114 Ga0466716_130134 3300042605 Bacteria 8491
115 Ga0466716_461987 3300042605 Bacteria 2057
116 Ga0123357_10013553 3300009784 Bacteria 10589
117 Ga0466712_042735 3300042614 Bacteria 35616
118 Ga0466712_222412 3300042614 Bacteria 15716
119 Ga0466715_138077 3300042616 Bacteria 28303
120 Ga0466715_227761 3300042616 Bacteria 2656
121 Ga0466723_206929 3300042618 Bacteria 10759
122 Ga0466723_347057 3300042618 Bacteria 8186
123 Ga0466726_102063 3300042619 Bacteria 17888
124 Ga0466726_301744 3300042619 Bacteria 4530
125 JGI24698J34947_10000404 3300002449 Bacteria 19671
126 JGI24698J34947_10017301 3300002449 Bacteria 3908
127 JGI24695J34938_10000529 3300002450 Bacteria 37004
128 JGI24702J35022_10015480 3300002462 Bacteria 4197
129 Ga0466690_311276 3300042590 Bacteria 1739
130 Ga0466691_004238 3300042593 Bacteria 8228
131 Ga0466691_092029 3300042593 Bacteria 20238
132 Ga0466694_077602 3300042594 Bacteria 6915
133 Ga0466696_055581 3300042596 Bacteria 7451
134 Ga0466696_118077 3300042596 Bacteria 22110
135 Ga0466696_157049 3300042596 Bacteria 12816
136 Ga0466699_427243 3300042597 Bacteria 5317
137 Ga0466703_084842 3300042636 Bacteria 9634
138 Ga0466703_199706 3300042636 Bacteria 15629
139 Ga0466704_111372 3300042643 Bacteria 52956
140 Ga0466704_206805 3300042643 Bacteria 7007
141 Ga0466727_075111 3300042655 Bacteria 4242
142 Ga0466727_336564 3300042655 Bacteria 5029
143 Ga0466706_126354 3300042599 Bacteria 11523
144 Ga0466717_188143 3300042604 Bacteria 1963
145 Ga0466698_075992 3300042610 Bacteria 12007
146 Ga0123353_10119497 3300010167 Bacteria 4239
147 Ga0466712_038554 3300042614 Bacteria 8844
148 Ga0466711_086153 3300042615 Bacteria 9171
149 Ga0466723_041794 3300042618 Bacteria 2136
150 Ga0466726_433141 3300042619 Bacteria 11551
151 Ga0466729_164583 3300042621 Bacteria 1929
152 JGI24698J34947_10010517 3300002449 Unclassified 5078
153 Ga0466691_205051 3300042593 Bacteria 12654
154 Ga0466695_221990 3300042595 Bacteria 77793
155 Ga0466704_477135 3300042643 Bacteria 8956
156 Ga0466708_066838 3300042652 Bacteria 32818
157 Ga0466705_216160 3300042612 Bacteria 2217
158 Ga0466733_160991 3300042659 Bacteria 8322
159 Ga0466716_181555 3300042605 Bacteria 7477
160 Ga0123356_10000246 3300010049 Bacteria 62303
161 Ga0466715_291797 3300042616 Bacteria 40545
162 Ga0466723_037529 3300042618 Bacteria 5102
163 Ga0466723_242371 3300042618 Bacteria 31023
164 Ga0466726_010172 3300042619 Bacteria 12413
165 Ga0466728_150806 3300042620 Bacteria 21274
166 Ga0466728_247552 3300042620 Bacteria 4861
167 AustNasuHG_c1003491 3300000089 Bacteria 5679
168 JGI24698J34947_10013237 3300002449 Unclassified 4507
169 JGI24698J34947_10058097 3300002449 Bacteria 1917
170 Ga0072941_1016875 3300005201 Bacteria 4627
171 Ga0264413_104575 3300024493 Bacteria 9076
172 Ga0466690_070518 3300042590 Bacteria 13128
173 Ga0466731_087164 3300042622 Bacteria 10910
174 Ga0466703_038302 3300042636 Bacteria 14635
175 Ga0466704_433789 3300042643 Bacteria 54851
176 Ga0466727_266785 3300042655 Bacteria 5787

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_425714 Ga0466696_425714_7978_9210 410
2 3300024493 Ga0264413_104689 Ga0264413_1046892 413
3 3300042606 Ga0466719_200254 Ga0466719_200254_30_1301 423
4 3300042618 Ga0466723_347057 Ga0466723_347057_1261_2580 439
5 3300042593 Ga0466691_004238 Ga0466691_004238_3821_5155 444
6 3300005201 Ga0072941_1007748 Ga0072941_100774814 450
7 3300005201 Ga0072941_1016875 Ga0072941_10168752 458
8 3300042636 Ga0466703_269294 Ga0466703_269294_7579_9084 470
9 3300042594 Ga0466694_285787 Ga0466694_285787_21991_23406 471
10 3300042636 Ga0466703_080701 Ga0466703_080701_6287_7702 471
11 3300042643 Ga0466704_152278 Ga0466704_152278_25_1521 471
12 3300042601 Ga0466707_386180 Ga0466707_386180_283_1701 472
13 3300042605 Ga0466716_461987 Ga0466716_461987_190_1608 472
14 3300042612 Ga0466705_474726 Ga0466705_474726_1274_2692 472
15 3300042616 Ga0466715_085574 Ga0466715_085574_5901_7373 472
16 3300042616 Ga0466715_138077 Ga0466715_138077_14024_15442 472
17 3300042618 Ga0466723_214354 Ga0466723_214354_5581_6999 472
18 3300042636 Ga0466703_038302 Ga0466703_038302_392_1810 472
19 3300042643 Ga0466704_111372 Ga0466704_111372_23998_25416 472
20 3300042648 Ga0466709_008898 Ga0466709_008898_2625_4043 472
21 3300042593 Ga0466691_092029 Ga0466691_092029_10391_11842 473
22 3300042602 Ga0466713_143614 Ga0466713_143614_580_2001 473
23 3300042622 Ga0466731_207283 Ga0466731_207283_4909_6330 473
24 3300024493 Ga0264413_104575 Ga0264413_10457514 474
25 3300038395 Ga0415639_005098 Ga0415639_005098_7901_9325 474
26 3300042591 Ga0466692_149322 Ga0466692_149322_3042_4466 474
27 3300042591 Ga0466692_200660 Ga0466692_200660_1056_2480 474
28 3300042592 Ga0466693_186633 Ga0466693_186633_3341_4765 474
29 3300042593 Ga0466691_033739 Ga0466691_033739_5804_7228 474
30 3300042593 Ga0466691_063934 Ga0466691_063934_4099_5523 474
31 3300042593 Ga0466691_155881 Ga0466691_155881_2356_3780 474
32 3300042594 Ga0466694_005840 Ga0466694_005840_26937_28361 474
33 3300042594 Ga0466694_077602 Ga0466694_077602_646_2070 474
34 3300042594 Ga0466694_202435 Ga0466694_202435_18057_19481 474
35 3300042594 Ga0466694_331591 Ga0466694_331591_450_1874 474
36 3300042596 Ga0466696_055581 Ga0466696_055581_669_2117 474
37 3300042596 Ga0466696_118077 Ga0466696_118077_585_2009 474
38 3300042596 Ga0466696_434397 Ga0466696_434397_1728_3152 474
39 3300042597 Ga0466699_427243 Ga0466699_427243_3547_4971 474
40 3300042604 Ga0466717_188143 Ga0466717_188143_55_1479 474
41 3300042605 Ga0466716_130134 Ga0466716_130134_5668_7092 474
42 3300042607 Ga0466720_234824 Ga0466720_234824_1579_3003 474
43 3300042609 Ga0466722_011447 Ga0466722_011447_658_2082 474
44 3300042609 Ga0466722_194617 Ga0466722_194617_1732_3156 474
45 3300042610 Ga0466698_075992 Ga0466698_075992_9191_10615 474
46 3300042612 Ga0466705_014464 Ga0466705_014464_132_1556 474
47 3300042612 Ga0466705_024137 Ga0466705_024137_725_2149 474
48 3300042612 Ga0466705_059722 Ga0466705_059722_9545_10969 474
49 3300042612 Ga0466705_199987 Ga0466705_199987_224_1648 474
50 3300042612 Ga0466705_216160 Ga0466705_216160_174_1598 474
51 3300042614 Ga0466712_033366 Ga0466712_033366_19596_21020 474
52 3300042614 Ga0466712_038554 Ga0466712_038554_7219_8643 474
53 3300042614 Ga0466712_043323 Ga0466712_043323_570_1994 474
54 3300042614 Ga0466712_043753 Ga0466712_043753_21698_23122 474
55 3300042614 Ga0466712_066846 Ga0466712_066846_3428_4852 474
56 3300042615 Ga0466711_030550 Ga0466711_030550_11649_13073 474
57 3300042615 Ga0466711_086153 Ga0466711_086153_827_2251 474
58 3300042615 Ga0466711_170233 Ga0466711_170233_149_1573 474
59 3300042616 Ga0466715_227761 Ga0466715_227761_1072_2496 474
60 3300042616 Ga0466715_252950 Ga0466715_252950_396_1820 474
61 3300042616 Ga0466715_291797 Ga0466715_291797_31823_33247 474
62 3300042616 Ga0466715_308927 Ga0466715_308927_15540_16964 474
63 3300042616 Ga0466715_378692 Ga0466715_378692_13529_14953 474
64 3300042618 Ga0466723_037529 Ga0466723_037529_756_2180 474
65 3300042618 Ga0466723_041794 Ga0466723_041794_351_1775 474
66 3300042618 Ga0466723_096576 Ga0466723_096576_977_2401 474
67 3300042618 Ga0466723_193287 Ga0466723_193287_316_1740 474
68 3300042618 Ga0466723_206929 Ga0466723_206929_548_1972 474
69 3300042618 Ga0466723_242371 Ga0466723_242371_11839_13263 474
70 3300042618 Ga0466723_289822 Ga0466723_289822_643_2067 474
71 3300042619 Ga0466726_301744 Ga0466726_301744_2849_4273 474
72 3300042620 Ga0466728_150806 Ga0466728_150806_5951_7375 474
73 3300042620 Ga0466728_247552 Ga0466728_247552_3102_4526 474
74 3300042620 Ga0466728_301164 Ga0466728_301164_113_1537 474
75 3300042620 Ga0466728_447202 Ga0466728_447202_611_2035 474
76 3300042621 Ga0466729_164583 Ga0466729_164583_38_1462 474
77 3300042622 Ga0466731_087164 Ga0466731_087164_3929_5353 474
78 3300042635 Ga0466702_039700 Ga0466702_039700_1549_2973 474
79 3300042635 Ga0466702_061677 Ga0466702_061677_320_1744 474
80 3300042635 Ga0466702_076095 Ga0466702_076095_1958_3382 474
81 3300042635 Ga0466702_192458 Ga0466702_192458_1009_2433 474
82 3300042635 Ga0466702_364223 Ga0466702_364223_606_2030 474
83 3300042635 Ga0466702_402965 Ga0466702_402965_149_1573 474
84 3300042636 Ga0466703_084842 Ga0466703_084842_2997_4421 474
85 3300042636 Ga0466703_086333 Ga0466703_086333_640_2064 474
86 3300042636 Ga0466703_185697 Ga0466703_185697_16103_17527 474
87 3300042643 Ga0466704_206805 Ga0466704_206805_1741_3165 474
88 3300042643 Ga0466704_357597 Ga0466704_357597_17781_19205 474
89 3300042643 Ga0466704_477135 Ga0466704_477135_3680_5104 474
90 3300042648 Ga0466709_027268 Ga0466709_027268_3038_4462 474
91 3300042652 Ga0466708_066838 Ga0466708_066838_27531_28955 474
92 3300042652 Ga0466708_159290 Ga0466708_159290_2152_3576 474
93 3300042652 Ga0466708_328366 Ga0466708_328366_772_2196 474
94 3300042652 Ga0466708_424368 Ga0466708_424368_4006_5430 474
95 3300042655 Ga0466727_075111 Ga0466727_075111_1866_3290 474
96 3300042655 Ga0466727_266785 Ga0466727_266785_1470_2894 474
97 3300042655 Ga0466727_336564 Ga0466727_336564_3287_4711 474
98 3300042656 Ga0466732_355699 Ga0466732_355699_417_1841 474
99 3300042659 Ga0466733_160991 Ga0466733_160991_4774_6198 474
100 iso_pr_bacteria 2772190978 2773730867 474
101 iso_pr_bacteria 2781125629 2781263321 474
102 iso_pr_bacteria 2781125630 2781266548 474
103 iso_pr_bacteria 2781125634 2781275423 474
104 iso_pr_bacteria 2781125636 2781280602 474
105 iso_pr_bacteria 2781125643 2781294128 474
106 iso_pr_bacteria 2781125646 2781301705 474
107 iso_pr_bacteria 2781125656 2781320416 474
108 iso_pr_bacteria 2781125657 2781323318 474
109 iso_pr_bacteria 2781125665 2781341263 474
110 iso_pr_bacteria 2781125687 2781421680 474
111 iso_pr_bacteria 2781125692 2781432184 474
112 iso_pr_bacteria 650716099 650878164 474
113 3300000089 AustNasuHG_c1016198 AustNasuHG_10161982 475
114 3300002449 JGI24698J34947_10000404 JGI24698J34947_1000040414 475
115 3300002449 JGI24698J34947_10010517 JGI24698J34947_100105172 475
116 3300002449 JGI24698J34947_10013237 JGI24698J34947_100132371 475
117 3300002449 JGI24698J34947_10016497 JGI24698J34947_100164972 475
118 3300002449 JGI24698J34947_10017301 JGI24698J34947_100173012 475
119 3300002449 JGI24698J34947_10017490 JGI24698J34947_100174903 475
120 3300002449 JGI24698J34947_10058097 JGI24698J34947_100580971 475
121 3300002450 JGI24695J34938_10000529 JGI24695J34938_1000052916 475
122 3300002450 JGI24695J34938_10000876 JGI24695J34938_100008765 475
123 3300002450 JGI24695J34938_10004610 JGI24695J34938_100046103 475
124 3300002450 JGI24695J34938_10011520 JGI24695J34938_100115202 475
125 3300005200 Ga0072940_1022677 Ga0072940_102267710 475
126 3300009784 Ga0123357_10013553 Ga0123357_100135532 475
127 3300009826 Ga0123355_10017180 Ga0123355_100171803 475
128 3300010049 Ga0123356_10000246 Ga0123356_1000024624 475
129 3300010049 Ga0123356_10000249 Ga0123356_1000024925 475
130 3300010049 Ga0123356_10005024 Ga0123356_100050246 475
131 3300010167 Ga0123353_10003165 Ga0123353_100031652 475
132 3300010167 Ga0123353_10119497 Ga0123353_101194972 475
133 3300010882 Ga0123354_10124759 Ga0123354_101247592 475
134 3300042590 Ga0466690_307022 Ga0466690_307022_563_2011 475
135 3300042648 Ga0466709_168442 Ga0466709_168442_8508_9935 475
136 3300000089 AustNasuHG_c1003491 AustNasuHG_10034914 476
137 3300042596 Ga0466696_157049 Ga0466696_157049_6589_8043 476
138 3300042614 Ga0466712_042735 Ga0466712_042735_29815_31245 476
139 3300042619 Ga0466726_394529 Ga0466726_394529_929_2359 476
140 3300042590 Ga0466690_311276 Ga0466690_311276_253_1686 477
141 3300042619 Ga0466726_102063 Ga0466726_102063_12698_14131 477
142 3300042648 Ga0466709_058054 Ga0466709_058054_5927_7360 477
143 3300042599 Ga0466706_213807 Ga0466706_213807_2749_4227 478
144 3300042619 Ga0466726_433141 Ga0466726_433141_5787_7223 478
145 3300042590 Ga0466690_362077 Ga0466690_362077_48_1487 479
146 3300042619 Ga0466726_126274 Ga0466726_126274_4661_6100 479
147 3300002462 JGI24702J35022_10015480 JGI24702J35022_100154803 480
148 3300042609 Ga0466722_072167 Ga0466722_072167_2436_3878 480
149 3300042619 Ga0466726_380186 Ga0466726_380186_128_1570 480
150 3300005083 Ga0068305_10013973 Ga0068305_100139737 481
151 3300042605 Ga0466716_140743 Ga0466716_140743_14611_16059 482
152 3300042605 Ga0466716_181555 Ga0466716_181555_1110_2558 482
153 3300042614 Ga0466712_222412 Ga0466712_222412_10932_12380 482
154 3300042615 Ga0466711_206135 Ga0466711_206135_2828_4276 482
155 3300042618 Ga0466723_150577 Ga0466723_150577_401_1849 482
156 3300042624 Ga0466735_102914 Ga0466735_102914_1795_3243 482
157 3300042590 Ga0466690_000984 Ga0466690_000984_1994_3445 483
158 3300042591 Ga0466692_164656 Ga0466692_164656_6117_7568 483
159 3300042593 Ga0466691_092461 Ga0466691_092461_17742_19193 483
160 3300042612 Ga0466705_013264 Ga0466705_013264_11595_13046 483
161 3300042616 Ga0466715_093039 Ga0466715_093039_195_1646 483
162 3300042636 Ga0466703_199706 Ga0466703_199706_7871_9322 483
163 3300042643 Ga0466704_250209 Ga0466704_250209_23401_24852 483
164 3300042652 Ga0466708_334476 Ga0466708_334476_2155_3609 484
165 3300042599 Ga0466706_126354 Ga0466706_126354_6365_7822 485
166 3300042652 Ga0466708_308305 Ga0466708_308305_1131_2588 485
167 3300042619 Ga0466726_010172 Ga0466726_010172_4695_6158 487
168 3300042619 Ga0466726_034060 Ga0466726_034060_9893_11359 488
169 3300042643 Ga0466704_366916 Ga0466704_366916_16884_18350 488
170 3300042601 Ga0466707_219043 Ga0466707_219043_120_1592 490
171 3300042590 Ga0466690_312592 Ga0466690_312592_3322_4797 491
172 3300042599 Ga0466706_030503 Ga0466706_030503_2485_3960 491
173 3300042590 Ga0466690_163825 Ga0466690_163825_373_1890 492
174 3300042643 Ga0466704_433789 Ga0466704_433789_40345_41823 492
175 3300042612 Ga0466705_106816 Ga0466705_106816_4320_5837 494
176 3300042614 Ga0466712_091209 Ga0466712_091209_1770_3254 494
177 3300042612 Ga0466705_498405 Ga0466705_498405_621_2108 495
178 3300042643 Ga0466704_032239 Ga0466704_032239_4304_5791 495
179 3300042652 Ga0466708_041552 Ga0466708_041552_1356_2867 503
180 3300042591 Ga0466692_120629 Ga0466692_120629_7969_9483 504
181 3300042596 Ga0466696_152232 Ga0466696_152232_5540_7054 504
182 3300042603 Ga0466714_042127 Ga0466714_042127_212_1735 507
183 3300042595 Ga0466695_221990 Ga0466695_221990_22351_23883 510
184 3300042591 Ga0466692_203028 Ga0466692_203028_3265_4809 514
185 3300042619 Ga0466726_301853 Ga0466726_301853_3055_4599 514
186 3300042593 Ga0466691_205051 Ga0466691_205051_7116_8675 519
187 3300042636 Ga0466703_061549 Ga0466703_061549_1274_2842 522
188 3300042590 Ga0466690_070518 Ga0466690_070518_6069_7727 525
189 3300042643 Ga0466704_411953 Ga0466704_411953_344_1921 525

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22422 MGH1-like_GH Mannosylglycerate hydrolase MGH1-like glycoside hydrolase domain 167 410 0.8
PF01204 Trehalase Trehalase 227 391 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.