Protein Family IF04480

Metagenome
144 Members
39 Samples
144 Scaffolds
342.16 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_070162|Ga0466690_070162_5894_7135
Length
396 aa
Sequence
LCSSFFFAKKLLFHIVRLENSCFSFNFTPIKNRKFIQMLNMESSKVYFTNLRTSSRSNLLDKMERLVNKAGLTTLELNKKFVAIKIHFGEPGNLAYLRPNYAARMANLLRQKGAKPFLTDSNTLYSGGRSNAVDHLQSAMENGYNPISAQCPVIIADGLKGTDYREIEFNGKYCKAPKIGAAIVDADVIVSMNHFKGHEQTGFGGALKNIGMGSASVGGKMELHSSSKPVITEDECRGCNICALHCAHNAIHLNADRIAEIDYAXXADYDTSEVLNCKIAEYTKAILDGKPHFHVNFIMNVSPECDCWNHNDAAIVPDIGIAASFDPVALDRACVDLVVRTPALPGSKLTESHREGINGQEDKFHLLHPDTNWQAGLDYAEELGIGTQEYELKEIG

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.9%
Kalotermitidae 33.3%
Termopsidae 10.3%
Unclassified 7.7%
Rhinotermitidae 5.1%
Passalidae 5.1%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10104997 3300010167 Bacteria 4552
2 Ga0466711_092222 3300042615 Bacteria 4026
3 Ga0466711_423820 3300042615 Bacteria 15490
4 Ga0466715_158674 3300042616 Bacteria 10773
5 Ga0466723_089388 3300042618 Bacteria 4777
6 Ga0466693_009343 3300042592 Bacteria 1241
7 Ga0466691_070652 3300042593 Bacteria 38932
8 Ga0466701_015189 3300042598 Bacteria 2047
9 Ga0466706_011591 3300042599 Bacteria 14693
10 Ga0466706_162916 3300042599 Bacteria 6936
11 Ga0466706_209165 3300042599 Bacteria 9936
12 Ga0466716_499717 3300042605 Bacteria 7950
13 Ga0466722_190914 3300042609 Bacteria 11284
14 Ga0466703_188971 3300042636 Bacteria 4291
15 Ga0466703_332216 3300042636 Bacteria 16803
16 Ga0466727_294996 3300042655 Bacteria 11299
17 2227103040 2225789004 Bacteria 1783
18 JGI24702J35022_10104342 3300002462 Bacteria 1555
19 Ga0123356_10130248 3300010049 Bacteria 2463
20 Ga0123353_10140010 3300010167 Bacteria 3876
21 Ga0466715_454534 3300042616 Bacteria 9177
22 Ga0466718_132491 3300042617 Bacteria 1122
23 Ga0466728_144965 3300042620 Bacteria 4745
24 Ga0466696_178693 3300042596 Bacteria 5946
25 Ga0466716_232262 3300042605 Bacteria 3894
26 Ga0466705_119653 3300042612 Bacteria 2440
27 Ga0466705_358193 3300042612 Bacteria 48237
28 Ga0466704_024785 3300042643 Bacteria 5574
29 Ga0466704_027730 3300042643 Bacteria 11942
30 Ga0466704_064913 3300042643 Bacteria 7599
31 Ga0466704_233934 3300042643 Bacteria 27297
32 2227538515 2225789004 Bacteria 15915
33 Ga0466711_007694 3300042615 Bacteria 9756
34 Ga0466715_018769 3300042616 Bacteria 7690
35 Ga0466715_050653 3300042616 Bacteria 2436
36 Ga0466723_244751 3300042618 Bacteria 7396
37 Ga0466723_360712 3300042618 Bacteria 17034
38 Ga0466696_104445 3300042596 Bacteria 5220
39 Ga0466706_142891 3300042599 Bacteria 15328
40 Ga0466706_236412 3300042599 Bacteria 28792
41 Ga0466719_023432 3300042606 Bacteria 5979
42 Ga0466719_574913 3300042606 Bacteria 2914
43 Ga0466703_010111 3300042636 Bacteria 16936
44 Ga0466704_179257 3300042643 Bacteria 5269
45 Ga0466704_294860 3300042643 Bacteria 1341
46 Ga0466704_316190 3300042643 Unclassified 9182
47 Ga0068302_10044950 3300005071 Bacteria 1798
48 Ga0068305_10025642 3300005083 Bacteria 5325
49 Ga0123354_10101638 3300010882 Bacteria 3881
50 Ga0466710_111045 3300042613 Bacteria 1960
51 Ga0466715_152546 3300042616 Bacteria 5585
52 Ga0466715_231386 3300042616 Bacteria 80319
53 Ga0466728_152836 3300042620 Bacteria 9394
54 Ga0466691_198184 3300042593 Unclassified 2585
55 Ga0466691_208696 3300042593 Bacteria 12985
56 Ga0466696_387414 3300042596 Bacteria 21871
57 Ga0466696_429416 3300042596 Bacteria 3696
58 Ga0466713_078158 3300042602 Unclassified 1732
59 Ga0466713_079418 3300042602 Bacteria 8411
60 Ga0466716_388133 3300042605 Bacteria 2212
61 Ga0466719_151748 3300042606 Bacteria 10010
62 Ga0466698_129485 3300042610 Bacteria 2075
63 Ga0466705_160446 3300042612 Bacteria 2435
64 Ga0466705_168033 3300042612 Bacteria 2713
65 Ga0466703_399651 3300042636 Bacteria 8975
66 Ga0466709_283657 3300042648 Bacteria 2347
67 Ga0068302_10043882 3300005071 Bacteria 9975
68 Ga0068302_10546900 3300005071 Bacteria 1931
69 Ga0466711_281334 3300042615 Bacteria 12036
70 Ga0466728_017616 3300042620 Bacteria 14659
71 Ga0466706_179395 3300042599 Bacteria 1025
72 Ga0466713_082847 3300042602 Bacteria 14596
73 Ga0466713_107113 3300042602 Bacteria 1782
74 Ga0466716_180048 3300042605 Bacteria 2804
75 Ga0466716_291467 3300042605 Bacteria 1764
76 Ga0466705_294084 3300042612 Bacteria 7696
77 Ga0466705_386007 3300042612 Bacteria 10413
78 Ga0466729_226489 3300042621 Bacteria 1941
79 Ga0466703_106494 3300042636 Bacteria 2670
80 Ga0466703_316316 3300042636 Bacteria 3182
81 Ga0466733_222306 3300042659 Bacteria 1723
82 IMNBL1DRAFT_c0008072 3300000062 Bacteria 5416
83 Ga0466711_029873 3300042615 Bacteria 2676
84 Ga0466711_209053 3300042615 Bacteria 8367
85 Ga0466715_036852 3300042616 Bacteria 2471
86 Ga0466715_448671 3300042616 Bacteria 9901
87 Ga0466723_149113 3300042618 Bacteria 1228
88 Ga0466726_021761 3300042619 Bacteria 4907
89 Ga0466726_042905 3300042619 Bacteria 14115
90 Ga0466690_020352 3300042590 Bacteria 4709
91 Ga0466696_173693 3300042596 Bacteria 3066
92 Ga0466701_017343 3300042598 Bacteria 1426
93 Ga0466713_011891 3300042602 Bacteria 19148
94 Ga0466713_042940 3300042602 Bacteria 4212
95 Ga0466716_243176 3300042605 Bacteria 10943
96 Ga0466735_023124 3300042624 Bacteria 3133
97 Ga0466704_198945 3300042643 Bacteria 26642
98 Ga0466704_364937 3300042643 Bacteria 10595
99 Ga0466732_299380 3300042656 Bacteria 1497
100 JGI24702J35022_10010841 3300002462 Bacteria 5085
101 JGI24702J35022_10098296 3300002462 Unclassified 1600
102 Ga0068302_10063982 3300005071 Bacteria 3323
103 Ga0068305_10034567 3300005083 Bacteria 2729
104 Ga0123354_10000021 3300010882 Bacteria 122100
105 Ga0466715_026497 3300042616 Bacteria 11841
106 Ga0466723_075931 3300042618 Bacteria 72847
107 Ga0466723_351316 3300042618 Bacteria 2249
108 Ga0466728_133087 3300042620 Bacteria 5086
109 Ga0466728_324049 3300042620 Bacteria 45950
110 Ga0466728_456796 3300042620 Bacteria 7991
111 Ga0466690_224713 3300042590 Bacteria 5244
112 Ga0466690_423485 3300042590 Bacteria 11428
113 Ga0466707_300769 3300042601 Bacteria 6332
114 Ga0466713_002398 3300042602 Bacteria 5715
115 Ga0466713_031099 3300042602 Bacteria 10373
116 Ga0466719_196853 3300042606 Unclassified 1927
117 Ga0466722_214336 3300042609 Bacteria 2451
118 Ga0466705_366592 3300042612 Unclassified 5917
119 Ga0466703_180200 3300042636 Bacteria 19638
120 Ga0466704_024389 3300042643 Bacteria 4898
121 Ga0466704_193705 3300042643 Bacteria 13994
122 Ga0466727_016314 3300042655 Bacteria 12921
123 Ga0466727_123905 3300042655 Bacteria 5342
124 IMNBL1DRAFT_c0026441 3300000062 Bacteria 2203
125 Ga0068305_10038920 3300005083 Bacteria 5212
126 Ga0466711_417850 3300042615 Bacteria 6071
127 Ga0466723_219467 3300042618 Bacteria 13446
128 Ga0415639_265304 3300038395 Unclassified 1244
129 Ga0466656_211103 3300042550 Bacteria 2738
130 Ga0466690_031105 3300042590 Bacteria 3006
131 Ga0466690_070162 3300042590 Bacteria 9495
132 Ga0466693_034399 3300042592 Unclassified 2057
133 Ga0466693_128180 3300042592 Bacteria 1528
134 Ga0466696_185779 3300042596 Bacteria 1505
135 Ga0466706_149496 3300042599 Bacteria 11511
136 Ga0466719_219114 3300042606 Bacteria 4717
137 Ga0466722_048871 3300042609 Bacteria 18842
138 Ga0466697_049753 3300042611 Bacteria 1640
139 Ga0466705_003446 3300042612 Bacteria 15410
140 Ga0466709_041701 3300042648 Bacteria 32131
141 Ga0466727_112528 3300042655 Bacteria 1700
142 Ga0466727_273374 3300042655 Bacteria 6961
143 Ga0466733_204380 3300042659 Bacteria 28684
144 JGI24702J35022_10000242 3300002462 Bacteria 31179

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_179395 Ga0466706_179395_14_973 292
2 3300042659 Ga0466733_204380 Ga0466733_204380_1696_2748 317
3 3300042606 Ga0466719_219114 Ga0466719_219114_955_2010 318
4 3300042615 Ga0466711_417850 Ga0466711_417850_3664_4716 318
5 3300010049 Ga0123356_10130248 Ga0123356_101302482 319
6 3300042596 Ga0466696_178693 Ga0466696_178693_568_1620 322
7 3300042602 Ga0466713_042940 Ga0466713_042940_796_1851 322
8 3300042612 Ga0466705_160446 Ga0466705_160446_40_1089 322
9 3300042617 Ga0466718_132491 Ga0466718_132491_55_1089 323
10 3300042605 Ga0466716_388133 Ga0466716_388133_171_1223 324
11 3300042616 Ga0466715_152546 Ga0466715_152546_1215_2267 324
12 3300042620 Ga0466728_324049 Ga0466728_324049_4871_5917 324
13 3300042616 Ga0466715_050653 Ga0466715_050653_111_1166 325
14 3300042636 Ga0466703_106494 Ga0466703_106494_151_1203 325
15 3300042596 Ga0466696_429416 Ga0466696_429416_2265_3350 326
16 3300042593 Ga0466691_198184 Ga0466691_198184_1465_2514 327
17 3300042616 Ga0466715_036852 Ga0466715_036852_365_1417 327
18 3300042636 Ga0466703_399651 Ga0466703_399651_5441_6490 327
19 3300042618 Ga0466723_219467 Ga0466723_219467_264_1310 328
20 3300042620 Ga0466728_456796 Ga0466728_456796_1904_2953 328
21 3300042624 Ga0466735_023124 Ga0466735_023124_196_1245 328
22 3300042590 Ga0466690_224713 Ga0466690_224713_252_1304 329
23 3300042618 Ga0466723_360712 Ga0466723_360712_14175_15227 329
24 3300042618 Ga0466723_351316 Ga0466723_351316_1140_2195 330
25 3300042643 Ga0466704_198945 Ga0466704_198945_21303_22364 330
26 3300042596 Ga0466696_185779 Ga0466696_185779_106_1224 332
27 3300042612 Ga0466705_294084 Ga0466705_294084_4494_5546 332
28 3300000062 IMNBL1DRAFT_c0008072 IMNBL1DRAFT_00080724 333
29 3300042598 Ga0466701_017343 Ga0466701_017343_109_1197 334
30 3300042655 Ga0466727_112528 Ga0466727_112528_502_1611 335
31 2225789004 2227538515 2228057972 336
32 3300042612 Ga0466705_003446 Ga0466705_003446_1048_2172 336
33 3300042619 Ga0466726_042905 Ga0466726_042905_4381_5496 336
34 3300042592 Ga0466693_128180 Ga0466693_128180_206_1324 337
35 3300042616 Ga0466715_231386 Ga0466715_231386_77813_78931 337
36 3300042618 Ga0466723_089388 Ga0466723_089388_3284_4402 337
37 3300042620 Ga0466728_152836 Ga0466728_152836_2743_3861 337
38 3300042636 Ga0466703_332216 Ga0466703_332216_1417_2535 337
39 3300042643 Ga0466704_027730 Ga0466704_027730_8780_9898 337
40 3300042643 Ga0466704_064913 Ga0466704_064913_5230_6348 337
41 3300042643 Ga0466704_316190 Ga0466704_316190_6535_7653 337
42 3300042655 Ga0466727_016314 Ga0466727_016314_7573_8691 337
43 3300038395 Ga0415639_265304 Ga0415639_265304_47_1129 338
44 3300042590 Ga0466690_020352 Ga0466690_020352_2014_3132 338
45 3300042599 Ga0466706_142891 Ga0466706_142891_8675_9790 338
46 3300042655 Ga0466727_273374 Ga0466727_273374_1336_2454 338
47 3300002462 JGI24702J35022_10104342 JGI24702J35022_101043421 339
48 3300042599 Ga0466706_011591 Ga0466706_011591_9965_11080 339
49 3300042611 Ga0466697_049753 Ga0466697_049753_175_1293 339
50 3300042612 Ga0466705_358193 Ga0466705_358193_45724_46842 339
51 3300042615 Ga0466711_092222 Ga0466711_092222_2463_3578 339
52 3300042643 Ga0466704_024389 Ga0466704_024389_3547_4665 339
53 3300042643 Ga0466704_179257 Ga0466704_179257_2186_3304 339
54 3300002462 JGI24702J35022_10000242 JGI24702J35022_1000024226 340
55 3300002462 JGI24702J35022_10010841 JGI24702J35022_100108413 340
56 3300042592 Ga0466693_009343 Ga0466693_009343_113_1231 340
57 3300042598 Ga0466701_015189 Ga0466701_015189_281_1399 340
58 3300042613 Ga0466710_111045 Ga0466710_111045_823_1941 340
59 3300042602 Ga0466713_031099 Ga0466713_031099_6860_7978 341
60 3300042606 Ga0466719_151748 Ga0466719_151748_3563_4681 341
61 3300042612 Ga0466705_168033 Ga0466705_168033_244_1362 341
62 3300042615 Ga0466711_007694 Ga0466711_007694_7088_8212 341
63 3300042636 Ga0466703_180200 Ga0466703_180200_6083_7201 341
64 3300042643 Ga0466704_024785 Ga0466704_024785_2009_3127 341
65 3300005083 Ga0068305_10038920 Ga0068305_100389203 342
66 3300010167 Ga0123353_10140010 Ga0123353_101400102 342
67 3300042602 Ga0466713_011891 Ga0466713_011891_4155_5273 342
68 3300042618 Ga0466723_244751 Ga0466723_244751_2165_3283 342
69 3300002462 JGI24702J35022_10098296 JGI24702J35022_100982962 343
70 3300042599 Ga0466706_149496 Ga0466706_149496_6762_7886 343
71 3300042605 Ga0466716_499717 Ga0466716_499717_3331_4455 343
72 3300042610 Ga0466698_129485 Ga0466698_129485_579_1697 343
73 3300042612 Ga0466705_366592 Ga0466705_366592_1309_2427 343
74 3300042615 Ga0466711_029873 Ga0466711_029873_723_1841 343
75 3300042615 Ga0466711_423820 Ga0466711_423820_4197_5315 343
76 3300042643 Ga0466704_233934 Ga0466704_233934_6153_7271 343
77 3300042599 Ga0466706_162916 Ga0466706_162916_4242_5363 344
78 3300042606 Ga0466719_574913 Ga0466719_574913_635_1753 344
79 3300042612 Ga0466705_119653 Ga0466705_119653_435_1553 344
80 3300042616 Ga0466715_026497 Ga0466715_026497_1403_2521 344
81 3300042656 Ga0466732_299380 Ga0466732_299380_184_1302 344
82 3300005071 Ga0068302_10063982 Ga0068302_100639822 345
83 3300042599 Ga0466706_236412 Ga0466706_236412_6761_7885 345
84 3300042602 Ga0466713_078158 Ga0466713_078158_494_1615 345
85 3300042609 Ga0466722_048871 Ga0466722_048871_3781_4899 345
86 3300042620 Ga0466728_144965 Ga0466728_144965_3512_4627 345
87 2225789004 2227103040 2227487495 346
88 3300010882 Ga0123354_10101638 Ga0123354_101016384 346
89 3300042602 Ga0466713_079418 Ga0466713_079418_1855_3000 346
90 3300042602 Ga0466713_082847 Ga0466713_082847_6854_7981 346
91 3300042605 Ga0466716_180048 Ga0466716_180048_785_1903 346
92 3300042606 Ga0466719_023432 Ga0466719_023432_1839_2960 346
93 3300042615 Ga0466711_209053 Ga0466711_209053_6970_8082 346
94 3300042620 Ga0466728_133087 Ga0466728_133087_3919_5031 346
95 3300042643 Ga0466704_294860 Ga0466704_294860_39_1157 346
96 3300005083 Ga0068305_10025642 Ga0068305_100256424 347
97 3300005083 Ga0068305_10034567 Ga0068305_100345672 347
98 3300042596 Ga0466696_387414 Ga0466696_387414_8590_9702 347
99 3300042605 Ga0466716_291467 Ga0466716_291467_160_1278 347
100 3300042609 Ga0466722_190914 Ga0466722_190914_5311_6429 347
101 3300042609 Ga0466722_214336 Ga0466722_214336_90_1208 347
102 3300042655 Ga0466727_123905 Ga0466727_123905_964_2085 347
103 3300042659 Ga0466733_222306 Ga0466733_222306_482_1600 347
104 3300000062 IMNBL1DRAFT_c0026441 IMNBL1DRAFT_00264412 348
105 3300005071 Ga0068302_10044950 Ga0068302_100449502 348
106 3300005071 Ga0068302_10546900 Ga0068302_105469002 348
107 3300042590 Ga0466690_031105 Ga0466690_031105_1873_2991 348
108 3300042599 Ga0466706_209165 Ga0466706_209165_3371_4495 348
109 3300042602 Ga0466713_002398 Ga0466713_002398_3027_4148 348
110 3300042605 Ga0466716_243176 Ga0466716_243176_1635_2762 348
111 3300042618 Ga0466723_149113 Ga0466723_149113_95_1213 348
112 3300042636 Ga0466703_316316 Ga0466703_316316_1693_2811 348
113 3300042648 Ga0466709_283657 Ga0466709_283657_194_1312 348
114 3300010882 Ga0123354_10000021 Ga0123354_100000217 349
115 3300042590 Ga0466690_423485 Ga0466690_423485_9869_10987 349
116 3300042602 Ga0466713_107113 Ga0466713_107113_388_1506 349
117 3300042615 Ga0466711_281334 Ga0466711_281334_8737_9855 349
118 3300042616 Ga0466715_018769 Ga0466715_018769_4986_6104 349
119 3300042616 Ga0466715_454534 Ga0466715_454534_4224_5342 349
120 3300042643 Ga0466704_193705 Ga0466704_193705_7161_8273 349
121 3300042550 Ga0466656_211103 Ga0466656_211103_1312_2430 350
122 3300042593 Ga0466691_208696 Ga0466691_208696_11698_12819 350
123 3300010167 Ga0123353_10104997 Ga0123353_101049975 351
124 3300042596 Ga0466696_173693 Ga0466696_173693_1026_2144 351
125 3300042606 Ga0466719_196853 Ga0466719_196853_789_1910 351
126 3300042612 Ga0466705_386007 Ga0466705_386007_3444_4628 351
127 3300042620 Ga0466728_017616 Ga0466728_017616_12087_13205 351
128 3300042643 Ga0466704_364937 Ga0466704_364937_2797_3981 351
129 3300042605 Ga0466716_232262 Ga0466716_232262_613_1731 352
130 3300042616 Ga0466715_448671 Ga0466715_448671_3444_4565 352
131 3300042648 Ga0466709_041701 Ga0466709_041701_8794_9906 353
132 3300042655 Ga0466727_294996 Ga0466727_294996_8685_9800 353
133 3300042636 Ga0466703_010111 Ga0466703_010111_11334_12452 354
134 3300042621 Ga0466729_226489 Ga0466729_226489_666_1781 355
135 3300042619 Ga0466726_021761 Ga0466726_021761_1133_2251 356
136 3300042592 Ga0466693_034399 Ga0466693_034399_429_1604 357
137 3300042636 Ga0466703_188971 Ga0466703_188971_1507_2661 357
138 3300042596 Ga0466696_104445 Ga0466696_104445_2873_4048 360
139 3300042616 Ga0466715_158674 Ga0466715_158674_2659_3828 367
140 3300042593 Ga0466691_070652 Ga0466691_070652_2196_3407 370
141 3300005071 Ga0068302_10043882 Ga0068302_100438826 373
142 3300042601 Ga0466707_300769 Ga0466707_300769_4255_5514 385
143 3300042618 Ga0466723_075931 Ga0466723_075931_51183_52403 393
144 3300042590 Ga0466690_070162 Ga0466690_070162_5894_7135 396

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04015 DUF362 Domain of unknown function (DUF362) 82 336 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.