Protein Family IF04479
Metagenome
Isolate
132
Members
60
Samples
122
Scaffolds
203.77
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_065944|Ga0466690_065944_6787_7518
- Length
- 243 aa
- Sequence
- MNRHIITYILDASALNSSTNYFVYFKILTTFAGKNQKRIIMHIAVAGNIGSGKTTLTGLLARHYGWQPKFEDVDDNPYLASFYKDMTRWSFNIQIYFLNKRFESIVEIQKSKATIIQDRTIYEDARIFAPNLHTMGLMTPRDFETYSSLFNLMTSLVRMPDVLIYLRSSVPTLVYQIQKRGRDYESGIRLDYLTKLNELYEAWIETYDGRKLIVDVDTVKFSETPEDLSLVIDKVDAQIHGLF
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
26.9%
Termitidae
26.9%
Armadillidiidae
9.6%
Termopsidae
7.7%
Passalidae
5.8%
Drosophilidae
3.8%
Apidae
3.8%
Formicidae
1.9%
Hodotermitidae
1.9%
Hydrophilidae
1.9%
Scarabaeidae
1.9%
Rhinotermitidae
1.9%
Culicidae
1.9%
Bombycidae
1.9%
Unclassified
1.9%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 2 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 3 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 8 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 17 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 18 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 40 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 41 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 42 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 45 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 51 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 52 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 55 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_167873 | 3300042656 | Bacteria | 2979 |
| 2 | Ga0466706_215464 | 3300042599 | Bacteria | 52926 |
| 3 | Ga0466714_083116 | 3300042603 | Bacteria | 1305 |
| 4 | Ga0466719_547459 | 3300042606 | Bacteria | 1017 |
| 5 | Ga0466724_11536 | 3300042649 | Bacteria | 2798 |
| 6 | Ga0160453_100400 | 3300012814 | Bacteria | 36021 |
| 7 | Ga0160453_100592 | 3300012814 | Bacteria | 24601 |
| 8 | Ga0160445_100311 | 3300012847 | Bacteria | 29371 |
| 9 | Ga0160457_1000001 | 3300012858 | Bacteria | 1192173 |
| 10 | Ga0466690_065944 | 3300042590 | Bacteria | 7729 |
| 11 | Ga0104050_1001306 | 3300007153 | Bacteria | 11120 |
| 12 | Ga0466733_141339 | 3300042659 | Bacteria | 6055 |
| 13 | Ga0123356_10915779 | 3300010049 | Bacteria | 1048 |
| 14 | Ga0123354_10056368 | 3300010882 | Bacteria | 5868 |
| 15 | Ga0466714_124697 | 3300042603 | Bacteria | 1264 |
| 16 | Ga0466714_154835 | 3300042603 | Bacteria | 1453 |
| 17 | Ga0466729_215809 | 3300042621 | Bacteria | 18744 |
| 18 | Ga0466703_030228 | 3300042636 | Bacteria | 5204 |
| 19 | Ga0466709_014846 | 3300042648 | Bacteria | 6300 |
| 20 | Ga0466709_164115 | 3300042648 | Bacteria | 18406 |
| 21 | Ga0160457_1003886 | 3300012858 | Bacteria | 2493 |
| 22 | Ga0466690_185414 | 3300042590 | Bacteria | 24173 |
| 23 | Ga0466690_240723 | 3300042590 | Bacteria | 3584 |
| 24 | Ga0466696_449869 | 3300042596 | Bacteria | 5455 |
| 25 | 2227511864 | 2225789004 | Bacteria | 3540 |
| 26 | IMNBL1DRAFT_c0008599 | 3300000062 | Unclassified | 5177 |
| 27 | JGI24698J34947_10052803 | 3300002449 | Unclassified | 2038 |
| 28 | Ga0466712_138759 | 3300042614 | Bacteria | 3122 |
| 29 | Ga0466715_268412 | 3300042616 | Bacteria | 25534 |
| 30 | Ga0466705_271408 | 3300042612 | Bacteria | 32327 |
| 31 | Ga0466706_027261 | 3300042599 | Bacteria | 24934 |
| 32 | Ga0466706_031289 | 3300042599 | Bacteria | 1399 |
| 33 | Ga0466706_088349 | 3300042599 | Unclassified | 2306 |
| 34 | Ga0466714_014038 | 3300042603 | Bacteria | 2854 |
| 35 | Ga0466719_064182 | 3300042606 | Bacteria | 2419 |
| 36 | Ga0466721_299891 | 3300042608 | Bacteria | 40566 |
| 37 | Ga0466729_287987 | 3300042621 | Bacteria | 5249 |
| 38 | Ga0466704_256614 | 3300042643 | Unclassified | 16687 |
| 39 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 40 | Ga0466709_390601 | 3300042648 | Bacteria | 5693 |
| 41 | Ga0466691_182502 | 3300042593 | Bacteria | 9838 |
| 42 | 2226985378 | 2225789003 | Bacteria | 1770 |
| 43 | IMNBL1DRAFT_c0012480 | 3300000062 | Bacteria | 3881 |
| 44 | JGI24702J35022_10015361 | 3300002462 | Bacteria | 4215 |
| 45 | JGI24702J35022_10066749 | 3300002462 | Bacteria | 1931 |
| 46 | Ga0068302_10007283 | 3300005071 | Unclassified | 2121 |
| 47 | Ga0103267_1000155 | 3300007190 | Bacteria | 26888 |
| 48 | Ga0466715_009808 | 3300042616 | Bacteria | 10434 |
| 49 | Ga0466726_013650 | 3300042619 | Bacteria | 1350 |
| 50 | Ga0466729_194834 | 3300042621 | Bacteria | 3550 |
| 51 | Ga0466697_191813 | 3300042611 | Bacteria | 2129 |
| 52 | Ga0466733_047328 | 3300042659 | Bacteria | 34018 |
| 53 | Ga0466714_063088 | 3300042603 | Bacteria | 1582 |
| 54 | Ga0466714_135388 | 3300042603 | Bacteria | 15085 |
| 55 | Ga0466735_101279 | 3300042624 | Bacteria | 1934 |
| 56 | Ga0466703_015892 | 3300042636 | Unclassified | 3044 |
| 57 | Ga0466709_058853 | 3300042648 | Unclassified | 16672 |
| 58 | Ga0466690_156003 | 3300042590 | Bacteria | 3738 |
| 59 | 2227507947 | 2225789004 | Bacteria | 71292 |
| 60 | JGI24702J35022_10079410 | 3300002462 | Bacteria | 1776 |
| 61 | Ga0104050_1001120 | 3300007153 | Bacteria | 3418 |
| 62 | Ga0466705_421314 | 3300042612 | Bacteria | 6916 |
| 63 | Ga0466711_075908 | 3300042615 | Unclassified | 1938 |
| 64 | Ga0466715_100346 | 3300042616 | Bacteria | 2701 |
| 65 | Ga0466723_011214 | 3300042618 | Bacteria | 7629 |
| 66 | Ga0466726_111458 | 3300042619 | Bacteria | 1503 |
| 67 | Ga0466705_201160 | 3300042612 | Bacteria | 6561 |
| 68 | Ga0466733_068311 | 3300042659 | Bacteria | 7775 |
| 69 | Ga0466703_089312 | 3300042636 | Bacteria | 6890 |
| 70 | Ga0466704_541797 | 3300042643 | Bacteria | 56608 |
| 71 | Ga0466708_209447 | 3300042652 | Bacteria | 14246 |
| 72 | Ga0466690_168792 | 3300042590 | Unclassified | 1319 |
| 73 | Ga0466696_220343 | 3300042596 | Bacteria | 6159 |
| 74 | JGI24702J35022_10439815 | 3300002462 | Bacteria | 793 |
| 75 | Ga0466715_310361 | 3300042616 | Bacteria | 7425 |
| 76 | Ga0466723_125737 | 3300042618 | Unclassified | 4422 |
| 77 | Ga0466723_284290 | 3300042618 | Bacteria | 2716 |
| 78 | Ga0466726_193950 | 3300042619 | Bacteria | 3875 |
| 79 | Ga0466726_267500 | 3300042619 | Bacteria | 4064 |
| 80 | Ga0466726_461629 | 3300042619 | Bacteria | 1357 |
| 81 | Ga0466728_472945 | 3300042620 | Bacteria | 1472 |
| 82 | Ga0466705_226735 | 3300042612 | Bacteria | 16080 |
| 83 | Ga0160454_100052 | 3300012798 | Bacteria | 179481 |
| 84 | Ga0466706_151566 | 3300042599 | Bacteria | 15700 |
| 85 | Ga0466714_032888 | 3300042603 | Bacteria | 1298 |
| 86 | Ga0466714_059318 | 3300042603 | Bacteria | 2896 |
| 87 | Ga0466717_016594 | 3300042604 | Bacteria | 1482 |
| 88 | Ga0466727_114730 | 3300042655 | Bacteria | 4731 |
| 89 | Ga0160468_100062 | 3300012819 | Bacteria | 150650 |
| 90 | Ga0160455_100128 | 3300012837 | Bacteria | 99906 |
| 91 | Ga0466691_164352 | 3300042593 | Unclassified | 3885 |
| 92 | Ga0466696_033318 | 3300042596 | Bacteria | 35735 |
| 93 | Ga0104045_1019673 | 3300007085 | Bacteria | 4152 |
| 94 | Ga0466715_246107 | 3300042616 | Bacteria | 6028 |
| 95 | Ga0466733_120948 | 3300042659 | Bacteria | 2261 |
| 96 | Ga0123356_11385145 | 3300010049 | Bacteria | 864 |
| 97 | Ga0123353_10001316 | 3300010167 | Bacteria | 30447 |
| 98 | Ga0123353_11242320 | 3300010167 | Bacteria | 973 |
| 99 | Ga0466706_039499 | 3300042599 | Unclassified | 1499 |
| 100 | Ga0466706_242307 | 3300042599 | Bacteria | 26824 |
| 101 | Ga0466706_252323 | 3300042599 | Bacteria | 13036 |
| 102 | Ga0466708_156244 | 3300042652 | Bacteria | 59741 |
| 103 | Ga0160458_100835 | 3300012832 | Bacteria | 8696 |
| 104 | Ga0104050_1209159 | 3300007153 | Unclassified | 1034 |
| 105 | Ga0466711_501371 | 3300042615 | Bacteria | 13480 |
| 106 | Ga0466723_023030 | 3300042618 | Bacteria | 16011 |
| 107 | Ga0466723_172825 | 3300042618 | Bacteria | 28507 |
| 108 | Ga0466706_063233 | 3300042599 | Bacteria | 14068 |
| 109 | Ga0466706_067008 | 3300042599 | Unclassified | 1406 |
| 110 | Ga0466706_252863 | 3300042599 | Bacteria | 9281 |
| 111 | Ga0466714_012807 | 3300042603 | Bacteria | 6600 |
| 112 | Ga0466714_022821 | 3300042603 | Bacteria | 19246 |
| 113 | Ga0466714_127057 | 3300042603 | Bacteria | 1092 |
| 114 | Ga0466716_063419 | 3300042605 | Bacteria | 3066 |
| 115 | Ga0160433_100052 | 3300012846 | Bacteria | 131130 |
| 116 | Ga0264413_149265 | 3300024493 | Bacteria | 1546 |
| 117 | IMNBL1DRAFT_c0004520 | 3300000062 | Bacteria | 8316 |
| 118 | JGI24705J35276_12231818 | 3300002504 | Bacteria | 4078 |
| 119 | Ga0072941_1148095 | 3300005201 | Unclassified | 4275 |
| 120 | Ga0466711_325872 | 3300042615 | Bacteria | 2653 |
| 121 | Ga0466715_316208 | 3300042616 | Bacteria | 15437 |
| 122 | Ga0466728_444703 | 3300042620 | Bacteria | 9461 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042599 | Ga0466706_067008 | Ga0466706_067008_883_1392 | 169 |
| 2 | 3300005071 | Ga0068302_10007283 | Ga0068302_100072831 | 199 |
| 3 | 3300042590 | Ga0466690_185414 | Ga0466690_185414_5516_6115 | 199 |
| 4 | 3300000062 | IMNBL1DRAFT_c0012480 | IMNBL1DRAFT_00124802 | 200 |
| 5 | 3300012858 | Ga0160457_1003886 | Ga0160457_10038862 | 200 |
| 6 | 3300042603 | Ga0466714_135388 | Ga0466714_135388_9499_10101 | 200 |
| 7 | 3300042599 | Ga0466706_027261 | Ga0466706_027261_10218_10823 | 201 |
| 8 | 3300042599 | Ga0466706_031289 | Ga0466706_031289_633_1238 | 201 |
| 9 | 3300042599 | Ga0466706_039499 | Ga0466706_039499_850_1455 | 201 |
| 10 | 3300042599 | Ga0466706_063233 | Ga0466706_063233_12255_12860 | 201 |
| 11 | 3300042599 | Ga0466706_088349 | Ga0466706_088349_315_920 | 201 |
| 12 | 3300042599 | Ga0466706_151566 | Ga0466706_151566_11425_12030 | 201 |
| 13 | 3300042599 | Ga0466706_215464 | Ga0466706_215464_3166_3771 | 201 |
| 14 | 3300042599 | Ga0466706_242307 | Ga0466706_242307_4703_5308 | 201 |
| 15 | 3300042599 | Ga0466706_252323 | Ga0466706_252323_5459_6064 | 201 |
| 16 | 3300042599 | Ga0466706_252863 | Ga0466706_252863_3427_4032 | 201 |
| 17 | 3300042603 | Ga0466714_012807 | Ga0466714_012807_3082_3687 | 201 |
| 18 | 3300042603 | Ga0466714_014038 | Ga0466714_014038_1956_2561 | 201 |
| 19 | 3300042603 | Ga0466714_022821 | Ga0466714_022821_16574_17179 | 201 |
| 20 | 3300042603 | Ga0466714_059318 | Ga0466714_059318_927_1532 | 201 |
| 21 | 3300042603 | Ga0466714_063088 | Ga0466714_063088_563_1168 | 201 |
| 22 | 3300042603 | Ga0466714_083116 | Ga0466714_083116_261_866 | 201 |
| 23 | 3300042603 | Ga0466714_124697 | Ga0466714_124697_476_1081 | 201 |
| 24 | 3300042603 | Ga0466714_127057 | Ga0466714_127057_152_757 | 201 |
| 25 | 3300042604 | Ga0466717_016594 | Ga0466717_016594_404_1009 | 201 |
| 26 | 3300042659 | Ga0466733_047328 | Ga0466733_047328_12476_13081 | 201 |
| 27 | 3300042659 | Ga0466733_141339 | Ga0466733_141339_2452_3057 | 201 |
| 28 | 3300010049 | Ga0123356_11385145 | Ga0123356_113851451 | 202 |
| 29 | 3300042619 | Ga0466726_111458 | Ga0466726_111458_278_886 | 202 |
| 30 | 3300042620 | Ga0466728_444703 | Ga0466728_444703_4400_5008 | 202 |
| 31 | 3300042621 | Ga0466729_287987 | Ga0466729_287987_1028_1636 | 202 |
| 32 | 3300042659 | Ga0466733_120948 | Ga0466733_120948_1519_2127 | 202 |
| 33 | 2225789003 | 2226985378 | 2227332622 | 203 |
| 34 | 2225789004 | 2227511864 | 2228006942 | 203 |
| 35 | 3300010882 | Ga0123354_10056368 | Ga0123354_100563682 | 203 |
| 36 | 3300024493 | Ga0264413_149265 | Ga0264413_1492652 | 203 |
| 37 | 3300042590 | Ga0466690_156003 | Ga0466690_156003_78_689 | 203 |
| 38 | 3300042590 | Ga0466690_168792 | Ga0466690_168792_512_1123 | 203 |
| 39 | 3300042593 | Ga0466691_164352 | Ga0466691_164352_523_1134 | 203 |
| 40 | 3300042593 | Ga0466691_182502 | Ga0466691_182502_3538_4149 | 203 |
| 41 | 3300042596 | Ga0466696_449869 | Ga0466696_449869_3323_3934 | 203 |
| 42 | 3300042603 | Ga0466714_032888 | Ga0466714_032888_599_1210 | 203 |
| 43 | 3300042603 | Ga0466714_154835 | Ga0466714_154835_585_1196 | 203 |
| 44 | 3300042606 | Ga0466719_064182 | Ga0466719_064182_665_1276 | 203 |
| 45 | 3300042612 | Ga0466705_201160 | Ga0466705_201160_600_1211 | 203 |
| 46 | 3300042612 | Ga0466705_226735 | Ga0466705_226735_14292_14903 | 203 |
| 47 | 3300042612 | Ga0466705_421314 | Ga0466705_421314_137_748 | 203 |
| 48 | 3300042614 | Ga0466712_138759 | Ga0466712_138759_2252_2863 | 203 |
| 49 | 3300042615 | Ga0466711_075908 | Ga0466711_075908_829_1440 | 203 |
| 50 | 3300042615 | Ga0466711_501371 | Ga0466711_501371_6176_6787 | 203 |
| 51 | 3300042616 | Ga0466715_009808 | Ga0466715_009808_7075_7686 | 203 |
| 52 | 3300042616 | Ga0466715_100346 | Ga0466715_100346_1532_2143 | 203 |
| 53 | 3300042616 | Ga0466715_246107 | Ga0466715_246107_2377_2988 | 203 |
| 54 | 3300042616 | Ga0466715_310361 | Ga0466715_310361_1340_1951 | 203 |
| 55 | 3300042616 | Ga0466715_316208 | Ga0466715_316208_8072_8683 | 203 |
| 56 | 3300042618 | Ga0466723_011214 | Ga0466723_011214_4437_5048 | 203 |
| 57 | 3300042618 | Ga0466723_023030 | Ga0466723_023030_6298_6909 | 203 |
| 58 | 3300042618 | Ga0466723_125737 | Ga0466723_125737_2783_3394 | 203 |
| 59 | 3300042618 | Ga0466723_172825 | Ga0466723_172825_3020_3631 | 203 |
| 60 | 3300042618 | Ga0466723_284290 | Ga0466723_284290_1645_2256 | 203 |
| 61 | 3300042619 | Ga0466726_013650 | Ga0466726_013650_255_866 | 203 |
| 62 | 3300042619 | Ga0466726_193950 | Ga0466726_193950_2877_3488 | 203 |
| 63 | 3300042619 | Ga0466726_461629 | Ga0466726_461629_383_994 | 203 |
| 64 | 3300042620 | Ga0466728_472945 | Ga0466728_472945_217_828 | 203 |
| 65 | 3300042624 | Ga0466735_101279 | Ga0466735_101279_1261_1872 | 203 |
| 66 | 3300042636 | Ga0466703_015892 | Ga0466703_015892_554_1165 | 203 |
| 67 | 3300042636 | Ga0466703_030228 | Ga0466703_030228_2425_3036 | 203 |
| 68 | 3300042636 | Ga0466703_089312 | Ga0466703_089312_5427_6038 | 203 |
| 69 | 3300042643 | Ga0466704_256614 | Ga0466704_256614_14521_15132 | 203 |
| 70 | 3300042643 | Ga0466704_541797 | Ga0466704_541797_44229_44840 | 203 |
| 71 | 3300042648 | Ga0466709_058853 | Ga0466709_058853_4726_5337 | 203 |
| 72 | 3300042648 | Ga0466709_390601 | Ga0466709_390601_586_1197 | 203 |
| 73 | 3300042652 | Ga0466708_156244 | Ga0466708_156244_35348_35959 | 203 |
| 74 | 3300042655 | Ga0466727_114730 | Ga0466727_114730_1484_2095 | 203 |
| 75 | 3300042656 | Ga0466732_167873 | Ga0466732_167873_1879_2490 | 203 |
| 76 | 3300042659 | Ga0466733_068311 | Ga0466733_068311_3747_4358 | 203 |
| 77 | 2225789004 | 2227507947 | 2227997950 | 204 |
| 78 | 3300000062 | IMNBL1DRAFT_c0004520 | IMNBL1DRAFT_00045205 | 204 |
| 79 | 3300002449 | JGI24698J34947_10052803 | JGI24698J34947_100528032 | 204 |
| 80 | 3300005201 | Ga0072941_1148095 | Ga0072941_11480956 | 204 |
| 81 | 3300010167 | Ga0123353_11242320 | Ga0123353_112423202 | 204 |
| 82 | 3300042596 | Ga0466696_220343 | Ga0466696_220343_5495_6109 | 204 |
| 83 | 3300042606 | Ga0466719_547459 | Ga0466719_547459_99_713 | 204 |
| 84 | 3300042608 | Ga0466721_299891 | Ga0466721_299891_20930_21544 | 204 |
| 85 | 3300042611 | Ga0466697_191813 | Ga0466697_191813_1084_1698 | 204 |
| 86 | 3300042615 | Ga0466711_325872 | Ga0466711_325872_1512_2126 | 204 |
| 87 | 3300042616 | Ga0466715_268412 | Ga0466715_268412_9001_9615 | 204 |
| 88 | 3300042648 | Ga0466709_014514 | Ga0466709_014514_336083_336697 | 204 |
| 89 | 3300042648 | Ga0466709_164115 | Ga0466709_164115_9573_10187 | 204 |
| 90 | 3300042652 | Ga0466708_209447 | Ga0466708_209447_8832_9446 | 204 |
| 91 | iso_pr_bacteria | 2785510743 | 2785736195 | 204 |
| 92 | iso_pr_bacteria | 2799112231 | 2799234142 | 204 |
| 93 | iso_pr_bacteria | 2832298047 | 2832299409 | 204 |
| 94 | iso_pr_bacteria | 2873776654 | 2873781390 | 204 |
| 95 | iso_pr_bacteria | 2896321640 | 2896325187 | 204 |
| 96 | iso_pr_bacteria | 2896330536 | 2896331763 | 204 |
| 97 | iso_pr_bacteria | 2896350215 | 2896351077 | 204 |
| 98 | iso_pr_bacteria | 2898741527 | 2898742100 | 204 |
| 99 | 3300000062 | IMNBL1DRAFT_c0008599 | IMNBL1DRAFT_00085993 | 205 |
| 100 | 3300002462 | JGI24702J35022_10015361 | JGI24702J35022_100153613 | 205 |
| 101 | 3300002462 | JGI24702J35022_10066749 | JGI24702J35022_100667491 | 205 |
| 102 | 3300002462 | JGI24702J35022_10079410 | JGI24702J35022_100794102 | 205 |
| 103 | 3300002462 | JGI24702J35022_10439815 | JGI24702J35022_104398151 | 205 |
| 104 | 3300007085 | Ga0104045_1019673 | Ga0104045_10196734 | 205 |
| 105 | 3300007153 | Ga0104050_1001306 | Ga0104050_10013067 | 205 |
| 106 | 3300007153 | Ga0104050_1209159 | Ga0104050_12091592 | 205 |
| 107 | 3300007190 | Ga0103267_1000155 | Ga0103267_100015511 | 205 |
| 108 | 3300010049 | Ga0123356_10915779 | Ga0123356_109157792 | 205 |
| 109 | 3300010167 | Ga0123353_10001316 | Ga0123353_1000131623 | 205 |
| 110 | 3300012798 | Ga0160454_100052 | Ga0160454_100052105 | 205 |
| 111 | 3300012814 | Ga0160453_100400 | Ga0160453_10040025 | 205 |
| 112 | 3300012814 | Ga0160453_100592 | Ga0160453_10059223 | 205 |
| 113 | 3300012819 | Ga0160468_100062 | Ga0160468_10006240 | 205 |
| 114 | 3300012832 | Ga0160458_100835 | Ga0160458_1008354 | 205 |
| 115 | 3300012837 | Ga0160455_100128 | Ga0160455_10012828 | 205 |
| 116 | 3300012846 | Ga0160433_100052 | Ga0160433_10005282 | 205 |
| 117 | 3300012847 | Ga0160445_100311 | Ga0160445_10031113 | 205 |
| 118 | 3300012858 | Ga0160457_1000001 | Ga0160457_1000001505 | 205 |
| 119 | 3300042612 | Ga0466705_271408 | Ga0466705_271408_901_1518 | 205 |
| 120 | 3300042648 | Ga0466709_014846 | Ga0466709_014846_3468_4085 | 205 |
| 121 | 3300007153 | Ga0104050_1001120 | Ga0104050_10011203 | 206 |
| 122 | 3300042619 | Ga0466726_267500 | Ga0466726_267500_879_1499 | 206 |
| 123 | 3300042649 | Ga0466724_11536 | Ga0466724_11536_1552_2172 | 206 |
| 124 | iso_pr_bacteria | 2579779088 | 2582237795 | 206 |
| 125 | 3300042621 | Ga0466729_194834 | Ga0466729_194834_2019_2642 | 207 |
| 126 | 3300042621 | Ga0466729_215809 | Ga0466729_215809_16226_16849 | 207 |
| 127 | iso_pr_bacteria | 2731957677 | 2732685801 | 208 |
| 128 | 3300002504 | JGI24705J35276_12231818 | JGI24705J35276_122318184 | 213 |
| 129 | 3300042596 | Ga0466696_033318 | Ga0466696_033318_8472_9122 | 216 |
| 130 | 3300042605 | Ga0466716_063419 | Ga0466716_063419_2194_2871 | 225 |
| 131 | 3300042590 | Ga0466690_240723 | Ga0466690_240723_1546_2229 | 227 |
| 132 | 3300042590 | Ga0466690_065944 | Ga0466690_065944_6787_7518 | 243 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01712 | dNK | Deoxynucleoside kinase | 43 | 238 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.