Protein Family IF04458

Metagenome Isolate
110 Members
47 Samples
90 Scaffolds
370.79 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_026801|Ga0466690_026801_2150_3403
Length
417 aa
Sequence
MRSLIFSILVLSLAACVAQDSLPLLDKAAFETTVDGRKTTLYTLKSGNGVIMQVTNFGARVISIWVPDKNGKYDDIAIGYENIDRYINNTGERFLGCVVGRYANRIAKGHFAIVDSTLNQGGRLSTLEVVEKRDENGNLISRDTLDMSKSLHTHSRVLSMHYQLPINNNGQTLHGGLKGLDMVVWDVKEASDTEIKFSYTSKDGDDGFPGNVTIDMTYTLTPQNEFRIDYQAVTDKSTVINLSNHTFFNLKGEANGTITDHILTINASHTTPVDSVLIPVGEIAPVDDTPFDFRKPTAIGERINLDNQQLKNGLGYDHNWVLDNTTGKVALAATLYEPVSGRVLEVYTDQPGLQFYSGNFFDGTYNGKYGKPIAFRETLALETQKFPDSPNHPNFPSTRLNPGETYTHTCIYRFLIK

📊 Sample Types

Isolate 18.2%
Metagenome 81.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.8%
Unclassified 14.9%
Termitidae 12.8%
Rhinotermitidae 10.6%
Armadillidiidae 8.5%
Blattidae 6.4%
Termopsidae 6.4%
Hydrophilidae 4.3%
Apidae 2.1%
Hodotermitidae 2.1%
Passalidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
9 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
14 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
33 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
34 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
37 3004672520 Bacteroides sp. 51 Isolate Blattidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123354_10005162 3300010882 Bacteria 18876
2 Ga0123354_10308711 3300010882 Bacteria 1482
3 Ga0466735_085652 3300042624 Bacteria 4832
4 Ga0466727_052508 3300042655 Bacteria 7468
5 Ga0160433_101231 3300012846 Bacteria 7582
6 Ga0466690_026801 3300042590 Bacteria 6137
7 Ga0466692_023509 3300042591 Bacteria 2880
8 Ga0466706_083615 3300042599 Unclassified 2412
9 Ga0466722_094675 3300042609 Bacteria 6981
10 Ga0466722_165491 3300042609 Bacteria 4502
11 Ga0466711_103583 3300042615 Bacteria 8624
12 Ga0466711_388602 3300042615 Bacteria 12898
13 Ga0466723_313196 3300042618 Bacteria 7133
14 Ga0466726_445903 3300042619 Bacteria 1623
15 Ga0466704_334247 3300042643 Bacteria 5681
16 Ga0466709_200595 3300042648 Bacteria 11830
17 Ga0466709_390589 3300042648 Bacteria 49108
18 Ga0466690_028914 3300042590 Bacteria 8668
19 Ga0466696_144382 3300042596 Bacteria 9452
20 Ga0466706_023510 3300042599 Bacteria 42194
21 Ga0466707_354135 3300042601 Bacteria 2429
22 Ga0466713_112609 3300042602 Bacteria 21903
23 Ga0466716_105025 3300042605 Bacteria 6430
24 Ga0466716_315422 3300042605 Bacteria 2648
25 Ga0466719_083337 3300042606 Bacteria 2361
26 Ga0466710_269956 3300042613 Bacteria 2907
27 Ga0466715_014882 3300042616 Bacteria 29632
28 Ga0466723_064574 3300042618 Bacteria 7056
29 Ga0466735_005040 3300042624 Bacteria 4201
30 Ga0466703_023372 3300042636 Bacteria 7055
31 Ga0466703_285101 3300042636 Bacteria 3936
32 Ga0466704_463254 3300042643 Bacteria 5866
33 Ga0466696_270387 3300042596 Bacteria 17241
34 IMNBL1DRAFT_c0011919 3300000062 Bacteria 4018
35 Ga0466715_200425 3300042616 Bacteria 12006
36 Ga0466715_298373 3300042616 Bacteria 35320
37 Ga0466735_075608 3300042624 Bacteria 2269
38 Ga0466703_194864 3300042636 Bacteria 11004
39 Ga0160445_100135 3300012847 Bacteria 64427
40 Ga0466690_008579 3300042590 Bacteria 25173
41 Ga0466692_046951 3300042591 Bacteria 32415
42 Ga0466695_381322 3300042595 Bacteria 1512
43 Ga0466715_173370 3300042616 Bacteria 6068
44 Ga0123357_10015185 3300009784 Bacteria 10091
45 Ga0466690_133773 3300042590 Bacteria 8840
46 Ga0466707_072171 3300042601 Bacteria 20367
47 Ga0466719_006711 3300042606 Bacteria 13342
48 Ga0466719_228253 3300042606 Bacteria 1575
49 Ga0466722_267924 3300042609 Bacteria 6562
50 Ga0466705_506364 3300042612 Bacteria 6465
51 Ga0466728_026829 3300042620 Bacteria 2216
52 Ga0466728_308661 3300042620 Bacteria 23749
53 Ga0466733_044535 3300042659 Bacteria 127501
54 Ga0466733_056399 3300042659 Bacteria 4736
55 Ga0466708_366709 3300042652 Bacteria 24882
56 Ga0466727_275937 3300042655 Bacteria 2557
57 Ga0160456_100116 3300012820 Bacteria 82604
58 Ga0456237_0001907 3300041968 Unclassified 3362
59 Ga0466692_098779 3300042591 Bacteria 3863
60 Ga0466713_051288 3300042602 Bacteria 230715
61 Ga0466713_053726 3300042602 Bacteria 131027
62 Ga0466719_319450 3300042606 Bacteria 13197
63 Ga0466722_150639 3300042609 Bacteria 7694
64 Ga0466708_082955 3300042652 Bacteria 55601
65 Ga0466727_086906 3300042655 Bacteria 13101
66 Ga0466691_144507 3300042593 Bacteria 2896
67 Ga0466699_163440 3300042597 Bacteria 1281
68 IMNBL1DRAFT_c0004891 3300000062 Bacteria 7863
69 Ga0466715_042591 3300042616 Bacteria 14628
70 Ga0466723_275943 3300042618 Bacteria 2391
71 Ga0466726_428833 3300042619 Bacteria 3593
72 Ga0466728_058128 3300042620 Bacteria 22542
73 Ga0466705_378213 3300042612 Bacteria 34876
74 Ga0466729_253924 3300042621 Bacteria 4249
75 Ga0466703_085844 3300042636 Bacteria 3928
76 Ga0466703_102634 3300042636 Bacteria 6214
77 Ga0466703_187956 3300042636 Bacteria 10003
78 Ga0466708_041066 3300042652 Bacteria 12959
79 Ga0466708_069504 3300042652 Bacteria 8479
80 Ga0466727_294845 3300042655 Bacteria 1880
81 Ga0160457_1011466 3300012858 Unclassified 1255
82 Ga0466690_165805 3300042590 Bacteria 4117
83 Ga0466692_108411 3300042591 Bacteria 15895
84 Ga0466716_356299 3300042605 Bacteria 4199
85 Ga0466711_334516 3300042615 Bacteria 25865
86 Ga0466711_372941 3300042615 Bacteria 8997
87 Ga0466723_071688 3300042618 Bacteria 16030
88 Ga0466723_089276 3300042618 Bacteria 12504
89 Ga0466726_052848 3300042619 Bacteria 9696
90 Ga0466728_159045 3300042620 Bacteria 3341

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820781750 2820783174 309
2 3300012858 Ga0160457_1011466 Ga0160457_10114662 334
3 3300041968 Ga0456237_0001907 Ga0456237_0001907_280_1290 336
4 3300042591 Ga0466692_023509 Ga0466692_023509_809_1819 336
5 iso_pr_bacteria 2781125683 2781410332 344
6 3300042643 Ga0466704_463254 Ga0466704_463254_2811_3878 347
7 3300042655 Ga0466727_086906 Ga0466727_086906_14_1063 349
8 3300042652 Ga0466708_069504 Ga0466708_069504_2351_3403 350
9 3300042602 Ga0466713_112609 Ga0466713_112609_10815_11870 351
10 3300042615 Ga0466711_334516 Ga0466711_334516_3035_4096 353
11 3300042618 Ga0466723_313196 Ga0466723_313196_1877_2938 353
12 3300042636 Ga0466703_187956 Ga0466703_187956_1241_2302 353
13 3300042648 Ga0466709_390589 Ga0466709_390589_26380_27441 353
14 3300042590 Ga0466690_028914 Ga0466690_028914_1421_2488 355
15 3300042605 Ga0466716_105025 Ga0466716_105025_3955_5022 355
16 3300042606 Ga0466719_006711 Ga0466719_006711_6581_7648 355
17 3300042612 Ga0466705_378213 Ga0466705_378213_32054_33121 355
18 3300042616 Ga0466715_042591 Ga0466715_042591_8597_9664 355
19 3300042619 Ga0466726_052848 Ga0466726_052848_1781_2848 355
20 3300042620 Ga0466728_058128 Ga0466728_058128_7178_8245 355
21 3300042652 Ga0466708_082955 Ga0466708_082955_36958_38025 355
22 3300042596 Ga0466696_270387 Ga0466696_270387_13092_14162 356
23 3300042602 Ga0466713_051288 Ga0466713_051288_182656_183726 356
24 3300042620 Ga0466728_159045 Ga0466728_159045_897_1967 356
25 3300042620 Ga0466728_308661 Ga0466728_308661_21750_22820 356
26 3300042659 Ga0466733_056399 Ga0466733_056399_2360_3493 358
27 iso_pr_bacteria 2910949487 2910949770 359
28 3300042609 Ga0466722_267924 Ga0466722_267924_863_1948 361
29 3300042596 Ga0466696_144382 Ga0466696_144382_8134_9225 363
30 3300042636 Ga0466703_023372 Ga0466703_023372_5117_6208 363
31 3300042616 Ga0466715_298373 Ga0466715_298373_32438_33532 364
32 3300042624 Ga0466735_005040 Ga0466735_005040_717_1856 364
33 3300042636 Ga0466703_194864 Ga0466703_194864_651_1748 365
34 3300042605 Ga0466716_315422 Ga0466716_315422_798_1919 366
35 3300042621 Ga0466729_253924 Ga0466729_253924_941_2065 367
36 3300009784 Ga0123357_10015185 Ga0123357_100151854 369
37 3300010882 Ga0123354_10308711 Ga0123354_103087111 369
38 3300042616 Ga0466715_014882 Ga0466715_014882_28020_29138 372
39 3300000062 IMNBL1DRAFT_c0004891 IMNBL1DRAFT_00048913 373
40 3300042590 Ga0466690_165805 Ga0466690_165805_305_1426 373
41 3300042591 Ga0466692_046951 Ga0466692_046951_13304_14425 373
42 3300042593 Ga0466691_144507 Ga0466691_144507_393_1514 373
43 3300042606 Ga0466719_319450 Ga0466719_319450_2829_3950 373
44 3300042612 Ga0466705_506364 Ga0466705_506364_1016_2137 373
45 3300042616 Ga0466715_200425 Ga0466715_200425_10125_11246 373
46 3300042618 Ga0466723_064574 Ga0466723_064574_3709_4830 373
47 3300042620 Ga0466728_026829 Ga0466728_026829_835_1956 373
48 3300042636 Ga0466703_085844 Ga0466703_085844_523_1644 373
49 3300042636 Ga0466703_102634 Ga0466703_102634_287_1408 373
50 3300042643 Ga0466704_334247 Ga0466704_334247_4461_5582 373
51 3300042652 Ga0466708_366709 Ga0466708_366709_13337_14458 373
52 3300042615 Ga0466711_103583 Ga0466711_103583_7009_8133 374
53 3300042618 Ga0466723_089276 Ga0466723_089276_5426_6550 374
54 iso_pr_bacteria 2820748953 2820749709 374
55 3300042590 Ga0466690_008579 Ga0466690_008579_7166_8293 375
56 3300042591 Ga0466692_108411 Ga0466692_108411_7317_8444 375
57 3300042597 Ga0466699_163440 Ga0466699_163440_67_1194 375
58 3300042602 Ga0466713_053726 Ga0466713_053726_98756_99883 375
59 3300042613 Ga0466710_269956 Ga0466710_269956_227_1354 375
60 3300042618 Ga0466723_275943 Ga0466723_275943_998_2125 375
61 3300042636 Ga0466703_285101 Ga0466703_285101_2282_3409 375
62 3300042652 Ga0466708_041066 Ga0466708_041066_8835_9962 375
63 3300042655 Ga0466727_052508 Ga0466727_052508_5123_6250 375
64 3300042595 Ga0466695_381322 Ga0466695_381322_172_1302 376
65 3300042606 Ga0466719_228253 Ga0466719_228253_132_1262 376
66 3300042609 Ga0466722_094675 Ga0466722_094675_3957_5087 376
67 3300042619 Ga0466726_428833 Ga0466726_428833_2236_3462 376
68 3300042648 Ga0466709_200595 Ga0466709_200595_10351_11481 376
69 iso_pr_bacteria 2910926975 2910928160 376
70 3300042601 Ga0466707_354135 Ga0466707_354135_878_2011 377
71 3300042605 Ga0466716_356299 Ga0466716_356299_2474_3607 377
72 3300042615 Ga0466711_388602 Ga0466711_388602_4533_5666 377
73 iso_pr_bacteria 2873600114 2873600194 377
74 iso_pr_bacteria 2873610414 2873610566 377
75 iso_pr_bacteria 2910949487 2910952007 377
76 3300042591 Ga0466692_098779 Ga0466692_098779_1395_2531 378
77 3300042601 Ga0466707_072171 Ga0466707_072171_10111_11247 378
78 3300042609 Ga0466722_150639 Ga0466722_150639_4281_5417 378
79 3300042609 Ga0466722_165491 Ga0466722_165491_2450_3586 378
80 3300042619 Ga0466726_445903 Ga0466726_445903_355_1491 378
81 3300042655 Ga0466727_275937 Ga0466727_275937_203_1339 378
82 3300042659 Ga0466733_044535 Ga0466733_044535_117610_118746 378
83 iso_pr_bacteria 3004672520 3004674940 378
84 3300042624 Ga0466735_075608 Ga0466735_075608_255_1394 379
85 3300042624 Ga0466735_085652 Ga0466735_085652_3675_4814 379
86 3300042599 Ga0466706_083615 Ga0466706_083615_285_1451 380
87 3300042616 Ga0466715_173370 Ga0466715_173370_4816_5958 380
88 iso_pr_bacteria 2695420317 2695486734 380
89 iso_pr_bacteria 8100157865 8100157870 380
90 3300042599 Ga0466706_023510 Ga0466706_023510_13456_14625 381
91 3300042655 Ga0466727_294845 Ga0466727_294845_566_1711 381
92 iso_pr_bacteria 2695420317 2695485169 381
93 iso_pr_bacteria 8100157865 8100161936 381
94 3300000062 IMNBL1DRAFT_c0011919 IMNBL1DRAFT_00119192 382
95 3300010882 Ga0123354_10005162 Ga0123354_100051626 383
96 iso_pr_bacteria 2910949487 2910951059 383
97 iso_pr_bacteria 2695420317 2695486801 384
98 iso_pr_bacteria 2873600114 2873601365 384
99 iso_pr_bacteria 2873610414 2873611723 384
100 iso_pr_bacteria 8100157865 8100159741 384
101 iso_pr_bacteria 2695420931 2698108626 385
102 3300012820 Ga0160456_100116 Ga0160456_10011663 386
103 3300012846 Ga0160433_101231 Ga0160433_1012313 386
104 3300042615 Ga0466711_372941 Ga0466711_372941_1645_2805 386
105 3300012847 Ga0160445_100135 Ga0160445_10013540 389
106 iso_pr_bacteria 8065497608 8065498240 392
107 3300042590 Ga0466690_133773 Ga0466690_133773_7409_8590 393
108 3300042618 Ga0466723_071688 Ga0466723_071688_7502_8683 393
109 3300042606 Ga0466719_083337 Ga0466719_083337_40_1284 414
110 3300042590 Ga0466690_026801 Ga0466690_026801_2150_3403 417

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01263 Aldose_epim Aldose 1-epimerase 161 413 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.