Protein Family IF04445

Metagenome Isolate
171 Members
48 Samples
165 Scaffolds
337.23 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_007234|Ga0466690_007234_284_1378
Length
352 aa
Sequence
MLKRARACKIKKVAAICGKYILWRKMMKRVLVIALTLTVAFGTVLFAGGKQAGGGNVHAVVFKSTGNPFGEKLMDGFETGVKEQGGTVVRRAPDLPTAEAQIQIIDQLIAQKVASITISANDFDALQPVLTKAKNAGIKIVTADSAVNPASRSVHINQADTKGIGEILVEAAFDQAGGASNQNAWIAVMEETLKQPKYANLKLVKIAYGDDLRDKSVSETEGLLASYPNLKVIVAPTTVGIAAAAKVISDRGLIGKVKITGLGLPSEMAEYISNGSCPYMFLWNPIDLGYLASYAAGALSSGTITGKTGDKFDGGKLGGYTVVQSGDGGTEVILGPPFKFEPSNINEWKSVY

📊 Sample Types

Isolate 2.9%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.4%
Kalotermitidae 29.8%
Unclassified 12.8%
Rhinotermitidae 8.5%
Termopsidae 6.4%
Passalidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 162
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
19 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
20 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
36 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_014464 3300042590 Bacteria 11796
2 Ga0466696_140273 3300042596 Bacteria 4532
3 Ga0466696_392844 3300042596 Bacteria 1939
4 Ga0466696_434531 3300042596 Bacteria 2827
5 Ga0123355_10003085 3300009826 Bacteria 23756
6 Ga0466715_210750 3300042616 Bacteria 13270
7 Ga0466726_185739 3300042619 Bacteria 5905
8 Ga0466726_326083 3300042619 Bacteria 9566
9 Ga0466728_446107 3300042620 Bacteria 10681
10 Ga0466703_099040 3300042636 Bacteria 5331
11 Ga0466704_057799 3300042643 Bacteria 1564
12 Ga0466704_268625 3300042643 Bacteria 59494
13 Ga0466709_267702 3300042648 Bacteria 14355
14 Ga0466727_287342 3300042655 Unclassified 1324
15 AustNasuHG_c1000592 3300000089 Bacteria 12795
16 JGI24698J34947_10005126 3300002449 Bacteria 7175
17 JGI24702J35022_10001060 3300002462 Bacteria 17188
18 JGI24700J35501_10930275 3300002508 Bacteria 12671
19 Ga0466705_009255 3300042612 Bacteria 3589
20 Ga0466705_020647 3300042612 Bacteria 15474
21 Ga0466705_118528 3300042612 Unclassified 6202
22 Ga0466716_061126 3300042605 Bacteria 6240
23 Ga0466691_021902 3300042593 Bacteria 3178
24 Ga0466691_173328 3300042593 Bacteria 22529
25 Ga0466691_175646 3300042593 Bacteria 4110
26 Ga0466705_474230 3300042612 Bacteria 3028
27 Ga0466711_341793 3300042615 Bacteria 5155
28 Ga0466718_110934 3300042617 Bacteria 3357
29 Ga0466726_182054 3300042619 Bacteria 13107
30 Ga0466704_185777 3300042643 Bacteria 11287
31 Ga0466708_193921 3300042652 Bacteria 1490
32 Ga0466708_467196 3300042652 Bacteria 15542
33 Ga0466727_302123 3300042655 Bacteria 2022
34 Ga0466727_308455 3300042655 Bacteria 22441
35 Ga0072940_1049412 3300005200 Bacteria 2627
36 Ga0466733_043680 3300042659 Bacteria 3645
37 Ga0466733_084293 3300042659 Bacteria 10083
38 Ga0466719_126368 3300042606 Bacteria 8275
39 Ga0466722_006745 3300042609 Bacteria 29004
40 Ga0466722_046317 3300042609 Bacteria 10772
41 Ga0466722_109095 3300042609 Bacteria 5639
42 Ga0466722_152893 3300042609 Bacteria 2702
43 Ga0466691_010385 3300042593 Unclassified 1759
44 Ga0466691_142836 3300042593 Bacteria 24101
45 Ga0466691_216648 3300042593 Bacteria 4893
46 Ga0123355_10040946 3300009826 Bacteria 7542
47 Ga0466715_276095 3300042616 Bacteria 16435
48 Ga0466715_337385 3300042616 Bacteria 28368
49 Ga0466715_352368 3300042616 Bacteria 41831
50 Ga0466723_005326 3300042618 Bacteria 6054
51 Ga0466723_189959 3300042618 Bacteria 1638
52 Ga0466723_257084 3300042618 Bacteria 3572
53 Ga0466723_324243 3300042618 Bacteria 9461
54 Ga0466728_059918 3300042620 Bacteria 2647
55 Ga0466729_295947 3300042621 Bacteria 2134
56 Ga0466702_292629 3300042635 Bacteria 1471
57 Ga0466703_104985 3300042636 Archaea 2489
58 Ga0466703_126133 3300042636 Bacteria 1548
59 Ga0466704_069544 3300042643 Bacteria 2885
60 Ga0466709_123916 3300042648 Unclassified 1539
61 Ga0466708_313738 3300042652 Bacteria 34279
62 Ga0466705_247175 3300042612 Bacteria 6140
63 Ga0466705_348785 3300042612 Bacteria 46858
64 Ga0466732_137461 3300042656 Bacteria 5460
65 Ga0466732_227501 3300042656 Bacteria 3292
66 Ga0466716_004127 3300042605 Bacteria 19130
67 Ga0466716_487633 3300042605 Unclassified 2831
68 Ga0466722_185202 3300042609 Bacteria 2676
69 Ga0264413_146090 3300024493 Bacteria 3040
70 Ga0466690_003223 3300042590 Bacteria 10701
71 Ga0466691_010979 3300042593 Bacteria 1658
72 Ga0466691_023525 3300042593 Bacteria 1230
73 Ga0466694_155148 3300042594 Bacteria 33595
74 Ga0466694_392238 3300042594 Bacteria 3118
75 Ga0466696_074360 3300042596 Bacteria 2054
76 Ga0123356_10178524 3300010049 Bacteria 2143
77 Ga0466715_029661 3300042616 Bacteria 14479
78 Ga0466715_117066 3300042616 Bacteria 10570
79 Ga0466723_103142 3300042618 Bacteria 2090
80 Ga0466726_308546 3300042619 Bacteria 3242
81 Ga0466726_400479 3300042619 Bacteria 2116
82 Ga0466726_490335 3300042619 Bacteria 2174
83 Ga0466703_332825 3300042636 Bacteria 6732
84 Ga0466704_067639 3300042643 Bacteria 9444
85 Ga0466708_073807 3300042652 Bacteria 5081
86 Ga0466708_261348 3300042652 Bacteria 4884
87 Ga0466708_292437 3300042652 Bacteria 2664
88 Ga0466708_434283 3300042652 Bacteria 3576
89 Ga0466727_014064 3300042655 Bacteria 1823
90 Ga0466727_169332 3300042655 Bacteria 1976
91 JGI24702J35022_10068541 3300002462 Bacteria 1907
92 JGI24705J35276_12226728 3300002504 Bacteria 2895
93 Ga0072940_1011864 3300005200 Bacteria 4450
94 Ga0466705_220056 3300042612 Bacteria 5902
95 Ga0466722_134165 3300042609 Bacteria 5465
96 Ga0466690_007234 3300042590 Bacteria 1493
97 Ga0466692_048877 3300042591 Bacteria 18134
98 Ga0466691_053406 3300042593 Bacteria 2199
99 Ga0466711_041135 3300042615 Bacteria 9157
100 Ga0466711_097180 3300042615 Bacteria 4266
101 Ga0466711_176014 3300042615 Bacteria 31697
102 Ga0466711_293488 3300042615 Bacteria 6926
103 Ga0466715_357043 3300042616 Bacteria 5307
104 Ga0466715_378738 3300042616 Bacteria 5123
105 Ga0466723_057705 3300042618 Bacteria 15524
106 Ga0466728_315825 3300042620 Unclassified 2105
107 Ga0466735_058388 3300042624 Bacteria 11868
108 Ga0466730_077064 3300042625 Bacteria 1120
109 Ga0466709_006307 3300042648 Bacteria 4194
110 Ga0466727_161476 3300042655 Bacteria 1408
111 Ga0466727_196086 3300042655 Bacteria 1837
112 Ga0466701_034158 3300042598 Bacteria 2601
113 Ga0466719_126527 3300042606 Bacteria 12884
114 Ga0456237_0000560 3300041968 Bacteria 5655
115 Ga0466690_128140 3300042590 Bacteria 1953
116 Ga0466691_054065 3300042593 Bacteria 2239
117 Ga0466699_262438 3300042597 Bacteria 1355
118 Ga0466711_325368 3300042615 Bacteria 3524
119 Ga0466718_007983 3300042617 Bacteria 11353
120 Ga0466718_076924 3300042617 Bacteria 2028
121 Ga0466723_157692 3300042618 Bacteria 11721
122 Ga0466728_021024 3300042620 Bacteria 2933
123 Ga0466728_188376 3300042620 Bacteria 2001
124 Ga0466703_062086 3300042636 Bacteria 35310
125 Ga0466703_071234 3300042636 Bacteria 32935
126 Ga0466703_083580 3300042636 Bacteria 4487
127 Ga0466708_213967 3300042652 Bacteria 6760
128 Ga0466708_332954 3300042652 Bacteria 1441
129 Ga0466727_024233 3300042655 Bacteria 3718
130 Ga0466705_025406 3300042612 Bacteria 1140
131 Ga0466705_068030 3300042612 Bacteria 27444
132 Ga0466705_216735 3300042612 Bacteria 10484
133 Ga0466716_320796 3300042605 Bacteria 1960
134 Ga0466691_012570 3300042593 Bacteria 32910
135 Ga0466695_246466 3300042595 Bacteria 7313
136 Ga0123356_10089402 3300010049 Bacteria 2930
137 Ga0466735_050164 3300042624 Bacteria 20969
138 Ga0466704_159641 3300042643 Bacteria 2626
139 Ga0466704_430127 3300042643 Bacteria 30975
140 Ga0466709_265960 3300042648 Bacteria 10518
141 Ga0466708_246011 3300042652 Bacteria 47079
142 Ga0466708_327322 3300042652 Bacteria 4193
143 Ga0466705_321082 3300042612 Bacteria 4628
144 Ga0466707_376109 3300042601 Bacteria 1443
145 Ga0466714_096467 3300042603 Bacteria 14942
146 Ga0466716_519839 3300042605 Bacteria 1571
147 Ga0466719_061225 3300042606 Bacteria 1612
148 Ga0466719_239229 3300042606 Unclassified 1909
149 Ga0466719_310052 3300042606 Bacteria 1643
150 Ga0466698_171573 3300042610 Bacteria 3109
151 Ga0466692_159472 3300042591 Bacteria 1866
152 Ga0466691_040082 3300042593 Unclassified 5346
153 Ga0466696_043350 3300042596 Bacteria 16584
154 Ga0466711_309380 3300042615 Bacteria 9841
155 Ga0466711_367078 3300042615 Bacteria 4888
156 Ga0466711_512684 3300042615 Bacteria 9534
157 Ga0466723_217029 3300042618 Bacteria 6535
158 Ga0466728_335995 3300042620 Bacteria 4565
159 Ga0466703_039954 3300042636 Bacteria 32713
160 Ga0466704_236505 3300042643 Bacteria 15020
161 Ga0466704_338205 3300042643 Bacteria 4816
162 Ga0466704_425485 3300042643 Bacteria 3403
163 Ga0466709_053184 3300042648 Bacteria 1667
164 IMNBL1DRAFT_c0034815 3300000062 Bacteria 1785
165 JGI24698J34947_10005927 3300002449 Bacteria 6703

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_315825 Ga0466728_315825_1203_2078 291
2 3300042593 Ga0466691_175646 Ga0466691_175646_435_1457 302
3 3300042612 Ga0466705_220056 Ga0466705_220056_4961_5875 304
4 3300042605 Ga0466716_320796 Ga0466716_320796_13_930 305
5 3300009826 Ga0123355_10003085 Ga0123355_1000308515 313
6 3300042618 Ga0466723_324243 Ga0466723_324243_7664_8719 313
7 3300042615 Ga0466711_176014 Ga0466711_176014_12031_13068 314
8 3300042636 Ga0466703_071234 Ga0466703_071234_5686_6702 315
9 3300042620 Ga0466728_188376 Ga0466728_188376_435_1472 316
10 3300000062 IMNBL1DRAFT_c0034815 IMNBL1DRAFT_00348152 317
11 3300042648 Ga0466709_053184 Ga0466709_053184_509_1546 319
12 3300002449 JGI24698J34947_10005126 JGI24698J34947_100051266 320
13 3300042596 Ga0466696_434531 Ga0466696_434531_194_1231 320
14 3300042606 Ga0466719_061225 Ga0466719_061225_121_1161 320
15 3300042648 Ga0466709_267702 Ga0466709_267702_3473_4507 322
16 3300042655 Ga0466727_014064 Ga0466727_014064_185_1234 322
17 3300042616 Ga0466715_276095 Ga0466715_276095_7667_8656 323
18 3300042616 Ga0466715_378738 Ga0466715_378738_1146_2162 324
19 3300042643 Ga0466704_069544 Ga0466704_069544_941_1990 325
20 3300042606 Ga0466719_310052 Ga0466719_310052_102_1118 326
21 3300042615 Ga0466711_097180 Ga0466711_097180_942_1991 326
22 3300042615 Ga0466711_367078 Ga0466711_367078_1896_2930 326
23 3300042619 Ga0466726_182054 Ga0466726_182054_11362_12390 326
24 3300042620 Ga0466728_021024 Ga0466728_021024_1269_2306 327
25 3300042616 Ga0466715_352368 Ga0466715_352368_20430_21434 328
26 3300042619 Ga0466726_400479 Ga0466726_400479_567_1607 328
27 3300042652 Ga0466708_246011 Ga0466708_246011_8473_9513 328
28 3300042655 Ga0466727_024233 Ga0466727_024233_2504_3544 328
29 3300042593 Ga0466691_021902 Ga0466691_021902_1127_2161 329
30 3300042612 Ga0466705_009255 Ga0466705_009255_2447_3436 329
31 3300042643 Ga0466704_425485 Ga0466704_425485_2151_3140 329
32 3300042652 Ga0466708_327322 Ga0466708_327322_173_1198 329
33 3300042591 Ga0466692_159472 Ga0466692_159472_366_1409 330
34 3300042615 Ga0466711_041135 Ga0466711_041135_5845_6879 330
35 3300042617 Ga0466718_076924 Ga0466718_076924_925_1947 330
36 3300042621 Ga0466729_295947 Ga0466729_295947_1004_2035 330
37 3300042625 Ga0466730_077064 Ga0466730_077064_19_1071 330
38 3300042655 Ga0466727_196086 Ga0466727_196086_803_1825 330
39 3300042593 Ga0466691_053406 Ga0466691_053406_164_1159 331
40 3300042636 Ga0466703_083580 Ga0466703_083580_2774_3811 331
41 3300042652 Ga0466708_193921 Ga0466708_193921_170_1207 331
42 3300042590 Ga0466690_128140 Ga0466690_128140_628_1662 332
43 3300042596 Ga0466696_392844 Ga0466696_392844_356_1354 332
44 3300042612 Ga0466705_118528 Ga0466705_118528_3802_4827 332
45 3300042615 Ga0466711_341793 Ga0466711_341793_2295_3335 332
46 3300042643 Ga0466704_430127 Ga0466704_430127_19560_20681 332
47 3300042655 Ga0466727_287342 Ga0466727_287342_181_1221 332
48 3300042593 Ga0466691_010385 Ga0466691_010385_595_1629 333
49 3300042612 Ga0466705_020647 Ga0466705_020647_2712_3749 333
50 3300042615 Ga0466711_293488 Ga0466711_293488_4497_5522 333
51 3300042620 Ga0466728_059918 Ga0466728_059918_669_1706 333
52 3300042636 Ga0466703_099040 Ga0466703_099040_677_1714 333
53 3300042652 Ga0466708_332954 Ga0466708_332954_189_1247 333
54 3300042603 Ga0466714_096467 Ga0466714_096467_12921_13925 334
55 3300042643 Ga0466704_338205 Ga0466704_338205_2801_3805 334
56 3300042655 Ga0466727_308455 Ga0466727_308455_1998_3002 334
57 3300042610 Ga0466698_171573 Ga0466698_171573_990_2012 335
58 iso_pr_bacteria 2781125656 2781319823 335
59 3300042620 Ga0466728_446107 Ga0466728_446107_4274_5329 336
60 3300042593 Ga0466691_054065 Ga0466691_054065_203_1234 337
61 3300042609 Ga0466722_109095 Ga0466722_109095_4495_5541 337
62 3300042617 Ga0466718_007983 Ga0466718_007983_4203_5216 337
63 3300042620 Ga0466728_335995 Ga0466728_335995_931_1944 337
64 iso_pr_bacteria 2772190978 2773730820 337
65 3300000089 AustNasuHG_c1000592 AustNasuHG_100059210 338
66 3300042595 Ga0466695_246466 Ga0466695_246466_5028_6044 338
67 3300042598 Ga0466701_034158 Ga0466701_034158_1226_2242 338
68 3300042601 Ga0466707_376109 Ga0466707_376109_182_1198 338
69 3300042605 Ga0466716_061126 Ga0466716_061126_4138_5154 338
70 3300042609 Ga0466722_152893 Ga0466722_152893_1387_2403 338
71 3300042609 Ga0466722_185202 Ga0466722_185202_1361_2377 338
72 3300042617 Ga0466718_110934 Ga0466718_110934_112_1128 338
73 3300042636 Ga0466703_126133 Ga0466703_126133_228_1244 338
74 3300042643 Ga0466704_057799 Ga0466704_057799_416_1432 338
75 3300042656 Ga0466732_137461 Ga0466732_137461_4188_5204 338
76 iso_pr_bacteria 2819994798 2819996448 338
77 3300002449 JGI24698J34947_10005927 JGI24698J34947_100059276 339
78 3300002462 JGI24702J35022_10001060 JGI24702J35022_1000106011 339
79 3300002462 JGI24702J35022_10068541 JGI24702J35022_100685412 339
80 3300002508 JGI24700J35501_10930275 JGI24700J35501_109302755 339
81 3300005200 Ga0072940_1011864 Ga0072940_10118645 339
82 3300005200 Ga0072940_1049412 Ga0072940_10494123 339
83 3300010049 Ga0123356_10178524 Ga0123356_101785241 339
84 3300042593 Ga0466691_012570 Ga0466691_012570_23892_24965 339
85 3300042593 Ga0466691_023525 Ga0466691_023525_201_1220 339
86 3300042593 Ga0466691_040082 Ga0466691_040082_2370_3389 339
87 3300042594 Ga0466694_392238 Ga0466694_392238_1272_2291 339
88 3300042618 Ga0466723_005326 Ga0466723_005326_4415_5434 339
89 3300042635 Ga0466702_292629 Ga0466702_292629_44_1063 339
90 3300042643 Ga0466704_159641 Ga0466704_159641_1084_2103 339
91 3300042643 Ga0466704_185777 Ga0466704_185777_1368_2387 339
92 3300042656 Ga0466732_227501 Ga0466732_227501_319_1338 339
93 3300002504 JGI24705J35276_12226728 JGI24705J35276_122267282 340
94 3300024493 Ga0264413_146090 Ga0264413_1460902 340
95 3300042597 Ga0466699_262438 Ga0466699_262438_170_1192 340
96 3300042605 Ga0466716_519839 Ga0466716_519839_23_1045 340
97 3300042612 Ga0466705_025406 Ga0466705_025406_32_1054 340
98 3300042612 Ga0466705_216735 Ga0466705_216735_3573_4595 340
99 3300042643 Ga0466704_236505 Ga0466704_236505_8614_9636 340
100 3300042652 Ga0466708_434283 Ga0466708_434283_2162_3184 340
101 3300042652 Ga0466708_467196 Ga0466708_467196_6108_7130 340
102 3300042659 Ga0466733_043680 Ga0466733_043680_2217_3239 340
103 3300042659 Ga0466733_084293 Ga0466733_084293_3079_4101 340
104 3300010049 Ga0123356_10089402 Ga0123356_100894021 341
105 3300042596 Ga0466696_140273 Ga0466696_140273_2462_3487 341
106 3300042615 Ga0466711_512684 Ga0466711_512684_1203_2228 341
107 3300042616 Ga0466715_357043 Ga0466715_357043_3980_5005 341
108 3300042618 Ga0466723_103142 Ga0466723_103142_306_1331 341
109 3300042619 Ga0466726_326083 Ga0466726_326083_3008_4033 341
110 3300042643 Ga0466704_067639 Ga0466704_067639_916_1941 341
111 3300042609 Ga0466722_046317 Ga0466722_046317_2941_3969 342
112 3300042594 Ga0466694_155148 Ga0466694_155148_4208_5239 343
113 3300042605 Ga0466716_487633 Ga0466716_487633_1663_2694 343
114 3300042609 Ga0466722_134165 Ga0466722_134165_4162_5193 343
115 3300042618 Ga0466723_257084 Ga0466723_257084_59_1090 343
116 3300042619 Ga0466726_308546 Ga0466726_308546_215_1246 343
117 3300042636 Ga0466703_039954 Ga0466703_039954_18146_19177 343
118 3300042643 Ga0466704_268625 Ga0466704_268625_20063_21094 343
119 3300042648 Ga0466709_006307 Ga0466709_006307_1699_2730 343
120 3300042648 Ga0466709_265960 Ga0466709_265960_7426_8457 343
121 3300042652 Ga0466708_073807 Ga0466708_073807_1266_2297 343
122 3300042652 Ga0466708_261348 Ga0466708_261348_793_1878 343
123 3300042652 Ga0466708_292437 Ga0466708_292437_638_1669 343
124 3300042590 Ga0466690_014464 Ga0466690_014464_5639_6673 344
125 3300042593 Ga0466691_010979 Ga0466691_010979_494_1528 344
126 3300042593 Ga0466691_142836 Ga0466691_142836_6994_8028 344
127 3300042605 Ga0466716_004127 Ga0466716_004127_16651_17685 344
128 3300042612 Ga0466705_068030 Ga0466705_068030_14615_15649 344
129 3300042612 Ga0466705_247175 Ga0466705_247175_1371_2405 344
130 3300042612 Ga0466705_474230 Ga0466705_474230_1569_2603 344
131 3300042618 Ga0466723_057705 Ga0466723_057705_8553_9587 344
132 3300042618 Ga0466723_157692 Ga0466723_157692_5354_6388 344
133 3300042618 Ga0466723_189959 Ga0466723_189959_85_1119 344
134 3300042655 Ga0466727_302123 Ga0466727_302123_389_1423 344
135 iso_pr_bacteria 2781125630 2781265132 344
136 3300042593 Ga0466691_216648 Ga0466691_216648_2558_3595 345
137 3300042606 Ga0466719_126368 Ga0466719_126368_1497_2534 345
138 3300042606 Ga0466719_239229 Ga0466719_239229_247_1284 345
139 3300042612 Ga0466705_348785 Ga0466705_348785_20880_21917 345
140 3300042615 Ga0466711_309380 Ga0466711_309380_2044_3081 345
141 3300042615 Ga0466711_325368 Ga0466711_325368_733_1770 345
142 3300042616 Ga0466715_117066 Ga0466715_117066_6104_7141 345
143 3300042618 Ga0466723_217029 Ga0466723_217029_68_1105 345
144 3300042636 Ga0466703_062086 Ga0466703_062086_3159_4196 345
145 3300042652 Ga0466708_313738 Ga0466708_313738_2421_3458 345
146 iso_pr_bacteria 2781125629 2781263078 345
147 3300041968 Ga0456237_0000560 Ga0456237_0000560_638_1678 346
148 3300042593 Ga0466691_173328 Ga0466691_173328_12403_13443 346
149 3300042616 Ga0466715_029661 Ga0466715_029661_10970_12010 346
150 3300042616 Ga0466715_210750 Ga0466715_210750_6253_7293 346
151 3300042619 Ga0466726_490335 Ga0466726_490335_171_1211 346
152 3300042624 Ga0466735_050164 Ga0466735_050164_17161_18201 346
153 3300042624 Ga0466735_058388 Ga0466735_058388_3562_4602 346
154 3300042655 Ga0466727_161476 Ga0466727_161476_325_1365 346
155 3300042655 Ga0466727_169332 Ga0466727_169332_753_1793 346
156 3300042606 Ga0466719_126527 Ga0466719_126527_1445_2488 347
157 3300042636 Ga0466703_104985 Ga0466703_104985_703_1746 347
158 3300042590 Ga0466690_003223 Ga0466690_003223_8580_9629 349
159 3300042619 Ga0466726_185739 Ga0466726_185739_755_1804 349
160 3300042612 Ga0466705_321082 Ga0466705_321082_1957_3009 350
161 3300042591 Ga0466692_048877 Ga0466692_048877_4467_5522 351
162 3300042596 Ga0466696_043350 Ga0466696_043350_13204_14259 351
163 3300042596 Ga0466696_074360 Ga0466696_074360_330_1385 351
164 3300042590 Ga0466690_007234 Ga0466690_007234_284_1378 352
165 3300042636 Ga0466703_039954 Ga0466703_039954_10937_12001 354
166 3300009826 Ga0123355_10040946 Ga0123355_100409465 355
167 3300042648 Ga0466709_123916 Ga0466709_123916_346_1413 355
168 3300042616 Ga0466715_337385 Ga0466715_337385_13024_14094 356
169 3300042636 Ga0466703_332825 Ga0466703_332825_514_1590 358
170 3300042652 Ga0466708_213967 Ga0466708_213967_1336_2427 363
171 3300042609 Ga0466722_006745 Ga0466722_006745_23946_25076 376

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13407 Peripla_BP_4 Periplasmic binding protein domain 59 302 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.