Protein Family IF04440
Metagenome
Isolate
219
Members
72
Samples
204
Scaffolds
185.91
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_398092|Ga0466657_398092_863_1522
- Length
- 210 aa
- Sequence
- MNDKNKINSHPATPLRGAKGLLYTITIFSENAVGVLNQITAIFMRRQLNIETLSVSPSAIEGIHKFTITAFSDCEETMKKLVRQIDKRVDIIKAWYNIDSELVHQELAMYKLSTEKVMEHGSVEYLIRKYNIRVLEITKDCVVFLKAGHYVETQGLFDELAAEIGVLQFVRSGRIAITNSPVERLSDMLEKREKERKLTILDCICVYIQQ
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.0%
Kalotermitidae
19.7%
Unclassified
14.1%
Apidae
7.0%
Rhinotermitidae
7.0%
Termopsidae
5.6%
Passalidae
2.8%
Hydrophilidae
2.8%
Hodotermitidae
1.4%
Blattidae
1.4%
Taxonomy
Archaea
0
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 15 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 16 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 51 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 52 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 53 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 57 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 58 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 64 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 65 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 66 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 67 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_239925 | 3300042611 | Bacteria | 3109 |
| 2 | Ga0466697_270275 | 3300042611 | Bacteria | 1650 |
| 3 | Ga0466733_103206 | 3300042659 | Bacteria | 4508 |
| 4 | Ga0466715_320777 | 3300042616 | Bacteria | 3182 |
| 5 | Ga0466723_224854 | 3300042618 | Bacteria | 2361 |
| 6 | Ga0466735_072241 | 3300042624 | Bacteria | 1763 |
| 7 | Ga0466703_122037 | 3300042636 | Bacteria | 17789 |
| 8 | Ga0466709_122295 | 3300042648 | Bacteria | 64864 |
| 9 | Ga0466708_069432 | 3300042652 | Bacteria | 45814 |
| 10 | Ga0466725_284076 | 3300042654 | Bacteria | 3112 |
| 11 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 12 | Ga0466694_361415 | 3300042594 | Bacteria | 6275 |
| 13 | Ga0123357_10077378 | 3300009784 | Bacteria | 4389 |
| 14 | Ga0123356_10390221 | 3300010049 | Bacteria | 1527 |
| 15 | Ga0123353_10159402 | 3300010167 | Bacteria | 3593 |
| 16 | Ga0123353_10215339 | 3300010167 | Bacteria | 3009 |
| 17 | Ga0123353_11572380 | 3300010167 | Bacteria | 832 |
| 18 | Ga0123354_10452433 | 3300010882 | Bacteria | 1039 |
| 19 | Ga0466713_009787 | 3300042602 | Bacteria | 6640 |
| 20 | Ga0466713_106508 | 3300042602 | Bacteria | 5240 |
| 21 | Ga0466716_097229 | 3300042605 | Bacteria | 3184 |
| 22 | Ga0466698_213897 | 3300042610 | Bacteria | 1590 |
| 23 | IMNBL1DRAFT_c0001620 | 3300000062 | Bacteria | 16684 |
| 24 | HBC_ctgsDRAFT_1000008 | 3300000333 | Bacteria | 58706 |
| 25 | JGI24705J35276_12106707 | 3300002504 | Bacteria | 1032 |
| 26 | JGI24705J35276_12226184 | 3300002504 | Bacteria | 2821 |
| 27 | JGI24696J40584_12956840 | 3300002834 | Bacteria | 3256 |
| 28 | Ga0466733_116931 | 3300042659 | Unclassified | 1848 |
| 29 | Ga0466711_358736 | 3300042615 | Unclassified | 2204 |
| 30 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 31 | Ga0466715_233135 | 3300042616 | Bacteria | 16848 |
| 32 | Ga0466715_236442 | 3300042616 | Bacteria | 10280 |
| 33 | Ga0466715_299499 | 3300042616 | Bacteria | 9218 |
| 34 | Ga0466715_342442 | 3300042616 | Bacteria | 12330 |
| 35 | Ga0466715_400350 | 3300042616 | Bacteria | 13257 |
| 36 | Ga0466726_115735 | 3300042619 | Bacteria | 1059 |
| 37 | Ga0466729_207040 | 3300042621 | Bacteria | 13457 |
| 38 | Ga0466731_159493 | 3300042622 | Bacteria | 1161 |
| 39 | Ga0466735_205403 | 3300042624 | Bacteria | 1151 |
| 40 | Ga0466703_183325 | 3300042636 | Bacteria | 3940 |
| 41 | Ga0466727_165946 | 3300042655 | Bacteria | 3289 |
| 42 | Ga0466692_163338 | 3300042591 | Bacteria | 1300 |
| 43 | Ga0466696_010740 | 3300042596 | Bacteria | 2020 |
| 44 | Ga0466696_330437 | 3300042596 | Bacteria | 7398 |
| 45 | Ga0123357_10015281 | 3300009784 | Bacteria | 10063 |
| 46 | Ga0123356_10576942 | 3300010049 | Unclassified | 1288 |
| 47 | Ga0123353_10490854 | 3300010167 | Bacteria | 1793 |
| 48 | Ga0123353_10603170 | 3300010167 | Bacteria | 1568 |
| 49 | Ga0123353_11122490 | 3300010167 | Bacteria | 1041 |
| 50 | Ga0123354_10261411 | 3300010882 | Bacteria | 1727 |
| 51 | Ga0466701_094151 | 3300042598 | Bacteria | 2326 |
| 52 | Ga0466713_028590 | 3300042602 | Bacteria | 6326 |
| 53 | Ga0466722_165738 | 3300042609 | Bacteria | 25578 |
| 54 | 2227477123 | 2225789004 | Bacteria | 4598 |
| 55 | 2227580177 | 2225789004 | Bacteria | 13433 |
| 56 | JGI24702J35022_10013770 | 3300002462 | Bacteria | 4471 |
| 57 | Ga0123357_10003621 | 3300009784 | Bacteria | 17805 |
| 58 | Ga0466705_344224 | 3300042612 | Bacteria | 18559 |
| 59 | Ga0466732_089580 | 3300042656 | Bacteria | 136356 |
| 60 | Ga0466732_222409 | 3300042656 | Bacteria | 1167 |
| 61 | Ga0466733_110639 | 3300042659 | Bacteria | 1284 |
| 62 | Ga0466734_011046 | 3300042623 | Bacteria | 2561 |
| 63 | Ga0466735_014219 | 3300042624 | Bacteria | 1841 |
| 64 | Ga0466735_210414 | 3300042624 | Bacteria | 1892 |
| 65 | Ga0466703_280652 | 3300042636 | Bacteria | 3048 |
| 66 | Ga0466727_087790 | 3300042655 | Bacteria | 7557 |
| 67 | Ga0466657_398120 | 3300042582 | Bacteria | 1007 |
| 68 | Ga0466690_203882 | 3300042590 | Unclassified | 6032 |
| 69 | Ga0466696_185562 | 3300042596 | Bacteria | 12858 |
| 70 | Ga0123357_10007479 | 3300009784 | Bacteria | 13506 |
| 71 | Ga0123357_10343520 | 3300009784 | Bacteria | 1439 |
| 72 | Ga0123357_10550629 | 3300009784 | Unclassified | 920 |
| 73 | Ga0123356_10105222 | 3300010049 | Bacteria | 2714 |
| 74 | Ga0123353_10709381 | 3300010167 | Bacteria | 1410 |
| 75 | Ga0123353_10826881 | 3300010167 | Bacteria | 1274 |
| 76 | Ga0123354_10285646 | 3300010882 | Bacteria | 1592 |
| 77 | Ga0466701_050285 | 3300042598 | Bacteria | 1032 |
| 78 | Ga0466707_406235 | 3300042601 | Bacteria | 12644 |
| 79 | Ga0466713_037065 | 3300042602 | Bacteria | 12817 |
| 80 | Ga0466716_019342 | 3300042605 | Bacteria | 10203 |
| 81 | Ga0466722_143687 | 3300042609 | Bacteria | 15059 |
| 82 | IMNBL1DRAFT_c0000566 | 3300000062 | Bacteria | 29938 |
| 83 | Ga0068302_10067333 | 3300005071 | Bacteria | 2705 |
| 84 | Ga0068302_10123313 | 3300005071 | Bacteria | 1061 |
| 85 | Ga0466705_122427 | 3300042612 | Bacteria | 8702 |
| 86 | Ga0466710_190848 | 3300042613 | Bacteria | 2987 |
| 87 | Ga0466710_295165 | 3300042613 | Bacteria | 4792 |
| 88 | Ga0466711_234814 | 3300042615 | Bacteria | 5367 |
| 89 | Ga0466711_266732 | 3300042615 | Bacteria | 11227 |
| 90 | Ga0466734_064407 | 3300042623 | Bacteria | 1312 |
| 91 | Ga0466703_352497 | 3300042636 | Bacteria | 2218 |
| 92 | Ga0466704_093851 | 3300042643 | Bacteria | 15363 |
| 93 | Ga0466704_484880 | 3300042643 | Bacteria | 9688 |
| 94 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 95 | Ga0466691_010581 | 3300042593 | Bacteria | 15300 |
| 96 | Ga0123357_10006927 | 3300009784 | Bacteria | 13923 |
| 97 | Ga0123357_10028960 | 3300009784 | Bacteria | 7507 |
| 98 | Ga0123356_10409511 | 3300010049 | Bacteria | 1495 |
| 99 | Ga0123356_11185448 | 3300010049 | Unclassified | 930 |
| 100 | Ga0123353_10219267 | 3300010167 | Bacteria | 2976 |
| 101 | Ga0123353_10285253 | 3300010167 | Bacteria | 2532 |
| 102 | Ga0123353_10435454 | 3300010167 | Bacteria | 1937 |
| 103 | Ga0466706_088489 | 3300042599 | Bacteria | 2586 |
| 104 | Ga0466707_099906 | 3300042601 | Bacteria | 4340 |
| 105 | Ga0466714_090913 | 3300042603 | Bacteria | 1429 |
| 106 | JGI24702J35022_10150548 | 3300002462 | Bacteria | 1305 |
| 107 | JGI24705J35276_12238426 | 3300002504 | Bacteria | 21664 |
| 108 | JGI24699J35502_11106685 | 3300002509 | Bacteria | 2534 |
| 109 | JGI24699J35502_11134223 | 3300002509 | Bacteria | 71514 |
| 110 | JGI24696J40584_12860565 | 3300002834 | Unclassified | 1010 |
| 111 | Ga0466697_142504 | 3300042611 | Bacteria | 1017 |
| 112 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 113 | Ga0466705_245540 | 3300042612 | Bacteria | 8406 |
| 114 | Ga0466733_042023 | 3300042659 | Bacteria | 2746 |
| 115 | Ga0466711_285818 | 3300042615 | Bacteria | 4987 |
| 116 | Ga0466715_468810 | 3300042616 | Unclassified | 1767 |
| 117 | Ga0466726_034871 | 3300042619 | Bacteria | 2777 |
| 118 | Ga0466729_062217 | 3300042621 | Bacteria | 9826 |
| 119 | Ga0466727_087020 | 3300042655 | Bacteria | 1383 |
| 120 | Ga0466656_294365 | 3300042550 | Bacteria | 1082 |
| 121 | Ga0466690_134518 | 3300042590 | Bacteria | 19266 |
| 122 | Ga0466692_179440 | 3300042591 | Bacteria | 21980 |
| 123 | Ga0466699_089172 | 3300042597 | Bacteria | 1087 |
| 124 | Ga0123353_12105622 | 3300010167 | Bacteria | 686 |
| 125 | Ga0123354_10107282 | 3300010882 | Bacteria | 3721 |
| 126 | Ga0466707_116060 | 3300042601 | Unclassified | 6991 |
| 127 | Ga0466713_035234 | 3300042602 | Bacteria | 43574 |
| 128 | Ga0466713_111742 | 3300042602 | Bacteria | 33326 |
| 129 | 2227662114 | 2225789004 | Bacteria | 1943 |
| 130 | JGI24702J35022_10012646 | 3300002462 | Bacteria | 4685 |
| 131 | JGI24702J35022_10122988 | 3300002462 | Bacteria | 1435 |
| 132 | JGI24696J40584_12960101 | 3300002834 | Bacteria | 6315 |
| 133 | Ga0466697_094467 | 3300042611 | Bacteria | 1145 |
| 134 | Ga0466715_086418 | 3300042616 | Bacteria | 17729 |
| 135 | Ga0466726_004285 | 3300042619 | Bacteria | 6393 |
| 136 | Ga0466726_068811 | 3300042619 | Bacteria | 4574 |
| 137 | Ga0466726_170656 | 3300042619 | Unclassified | 1667 |
| 138 | Ga0466726_381871 | 3300042619 | Bacteria | 3897 |
| 139 | Ga0466735_111817 | 3300042624 | Unclassified | 3616 |
| 140 | Ga0466703_398120 | 3300042636 | Bacteria | 1773 |
| 141 | Ga0466709_197212 | 3300042648 | Bacteria | 2566 |
| 142 | Ga0466724_32683 | 3300042649 | Bacteria | 1115 |
| 143 | Ga0466727_210311 | 3300042655 | Bacteria | 3162 |
| 144 | Ga0456237_0000004 | 3300041968 | Bacteria | 74187 |
| 145 | Ga0466657_398092 | 3300042582 | Bacteria | 2320 |
| 146 | Ga0466695_295306 | 3300042595 | Bacteria | 2130 |
| 147 | Ga0466696_123114 | 3300042596 | Bacteria | 18671 |
| 148 | Ga0123356_10577765 | 3300010049 | Bacteria | 1287 |
| 149 | Ga0123353_10000023 | 3300010167 | Bacteria | 173512 |
| 150 | Ga0123353_10127125 | 3300010167 | Bacteria | 4096 |
| 151 | Ga0123354_10315252 | 3300010882 | Unclassified | 1453 |
| 152 | Ga0466701_032343 | 3300042598 | Bacteria | 11792 |
| 153 | Ga0466701_034057 | 3300042598 | Bacteria | 1402 |
| 154 | Ga0466707_327412 | 3300042601 | Bacteria | 33932 |
| 155 | Ga0466714_083226 | 3300042603 | Bacteria | 3348 |
| 156 | Ga0466719_370020 | 3300042606 | Bacteria | 7988 |
| 157 | Ga0466719_427797 | 3300042606 | Unclassified | 3511 |
| 158 | Ga0466697_237686 | 3300042611 | Bacteria | 1211 |
| 159 | Ga0466733_132398 | 3300042659 | Bacteria | 1192 |
| 160 | Ga0466710_216795 | 3300042613 | Bacteria | 1907 |
| 161 | Ga0466711_133593 | 3300042615 | Bacteria | 12478 |
| 162 | Ga0466735_159986 | 3300042624 | Bacteria | 4166 |
| 163 | Ga0466703_160262 | 3300042636 | Bacteria | 1326 |
| 164 | Ga0466657_092336 | 3300042582 | Unclassified | 10107 |
| 165 | Ga0466693_024046 | 3300042592 | Bacteria | 4596 |
| 166 | Ga0123356_10998846 | 3300010049 | Bacteria | 1007 |
| 167 | Ga0123356_11508221 | 3300010049 | Bacteria | 830 |
| 168 | Ga0466701_097135 | 3300042598 | Bacteria | 9341 |
| 169 | 2227467932 | 2225789004 | Bacteria | 951 |
| 170 | IMNBL1DRAFT_c0003404 | 3300000062 | Bacteria | 10260 |
| 171 | JGI24702J35022_10007298 | 3300002462 | Bacteria | 6345 |
| 172 | JGI24702J35022_10207209 | 3300002462 | Bacteria | 1124 |
| 173 | Ga0068305_10052790 | 3300005083 | Bacteria | 7837 |
| 174 | Ga0072941_1002325 | 3300005201 | Bacteria | 2990 |
| 175 | Ga0466705_034325 | 3300042612 | Bacteria | 4608 |
| 176 | Ga0466733_152247 | 3300042659 | Bacteria | 20641 |
| 177 | Ga0466710_354296 | 3300042613 | Bacteria | 2009 |
| 178 | Ga0466723_085628 | 3300042618 | Bacteria | 14016 |
| 179 | Ga0466726_012209 | 3300042619 | Bacteria | 17316 |
| 180 | Ga0466728_226176 | 3300042620 | Unclassified | 4248 |
| 181 | Ga0466735_025453 | 3300042624 | Bacteria | 25354 |
| 182 | Ga0466735_149055 | 3300042624 | Bacteria | 3538 |
| 183 | Ga0466704_278206 | 3300042643 | Bacteria | 3436 |
| 184 | Ga0466727_103787 | 3300042655 | Unclassified | 3716 |
| 185 | Ga0466657_390369 | 3300042582 | Bacteria | 1311 |
| 186 | Ga0466690_171369 | 3300042590 | Bacteria | 11350 |
| 187 | Ga0466692_110912 | 3300042591 | Bacteria | 24580 |
| 188 | Ga0466696_105895 | 3300042596 | Bacteria | 3898 |
| 189 | Ga0123356_10436843 | 3300010049 | Bacteria | 1454 |
| 190 | Ga0123354_10010165 | 3300010882 | Bacteria | 14476 |
| 191 | Ga0123354_10357013 | 3300010882 | Bacteria | 1294 |
| 192 | Ga0123354_10467356 | 3300010882 | Unclassified | 1008 |
| 193 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 194 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 195 | Ga0466707_075455 | 3300042601 | Bacteria | 9140 |
| 196 | Ga0466717_116060 | 3300042604 | Bacteria | 1635 |
| 197 | Ga0466716_366554 | 3300042605 | Bacteria | 7525 |
| 198 | Ga0466719_349227 | 3300042606 | Bacteria | 6569 |
| 199 | Ga0466722_199911 | 3300042609 | Bacteria | 40153 |
| 200 | 2227488552 | 2225789004 | Bacteria | 4164 |
| 201 | JGI24702J35022_10008167 | 3300002462 | Bacteria | 5945 |
| 202 | JGI24702J35022_10052098 | 3300002462 | Bacteria | 2181 |
| 203 | JGI24705J35276_12237464 | 3300002504 | Bacteria | 11218 |
| 204 | Ga0068305_10020762 | 3300005083 | Unclassified | 2109 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.