Protein Family IF04438

Metagenome Isolate
267 Members
189 Samples
153 Scaffolds
249.57 Avg Length

🧬 Representative Sequence

ID
3300042582|Ga0466657_378630|Ga0466657_378630_1030_1887
Length
285 aa
Sequence
LPPSSIPKKARITDCVSIEIFSTGTPDFHTRLLRGLAMLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMALKWVQAGARRLHLVDLNGAFAGKPQNHVAIKAILRAVGDDIPVQLGGGIRDLDTIERYIDNGLRYVIIGTAAVKNPGFLKDACSAFGGHIIVGLDAKDGKVATDGWSKLTGHEVADLGKKFEDYGVESIIYTDIGRDGMLSGINIEATVRLAQALTIPVIASGGLSNMADIENLCAVEDEGIEGVICGRAIYSGDLDFADAQARADELTGAG

📊 Sample Types

Isolate 42.7%
Metagenome 57.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 43.5%
Termitidae 12.5%
Unclassified 9.8%
Formicidae 8.2%
Kalotermitidae 7.1%
Culicidae 4.3%
Elmidae 3.8%
Rhinotermitidae 1.6%
Curculionidae 1.6%
Termopsidae 1.6%
Largidae 1.1%
Hydrophilidae 1.1%
Alydidae 1.1%
Berytidae 1.1%
Passalidae 0.5%
Drosophilidae 0.5%
Armadillidiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 253
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
2 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
3 2864755708 Massilia timonae S00006 Isolate Elmidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
10 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
11 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
12 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
13 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
14 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
15 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
16 8100455565 Delftia sp. S67 Isolate Curculionidae
17 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
18 8102102351 Caballeronia sp. INML1 Isolate Coreidae
19 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
20 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
21 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
22 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
25 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
29 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
30 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
34 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
35 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
36 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
37 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
38 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
39 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
40 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
41 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
42 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
43 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
44 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
47 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
48 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
49 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
50 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
51 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
52 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
53 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
54 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
55 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
56 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
57 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
58 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
59 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
60 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
61 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
62 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
64 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
65 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
66 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
67 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
68 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
69 8100449422 Delftia sp. S66 Isolate Curculionidae
70 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
71 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
72 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
73 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
74 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
75 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
76 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
77 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
78 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
79 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
80 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
81 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
82 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
83 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
84 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
85 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
86 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
87 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
88 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
89 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
90 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
91 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
92 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
93 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
94 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
95 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
96 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
97 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
98 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
99 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
100 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
101 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
102 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
103 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
104 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
105 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
106 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
107 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
108 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
109 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
110 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
111 2864937364 Acidovorax soli S00198 Isolate Elmidae
112 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
113 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
114 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
115 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
116 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
117 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
118 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
119 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
120 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
121 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
122 8102117041 Caballeronia sp. INML3 Isolate Coreidae
123 8102131453 Caballeronia sp. INML5 Isolate Coreidae
124 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
125 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
126 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
127 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
128 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
129 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
130 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
131 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
132 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
133 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
134 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
135 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
136 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
137 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
138 2603880165 Burkholderiales A1 Isolate Unclassified
139 2603880172 Burkholderiales C Isolate Unclassified
140 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
141 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
142 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
143 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
144 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
145 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
146 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
147 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
148 8102124461 Caballeronia sp. INML3B Isolate Coreidae
149 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
150 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
151 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
152 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
153 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
154 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
155 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
156 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
157 8069748016 Caballeronia sp. LP003 Isolate Coreidae
158 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
159 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
160 8102109360 Caballeronia sp. INML2 Isolate Coreidae
161 8102145433 Caballeronia sp. LP006 Isolate Coreidae
162 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
163 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
164 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
165 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
166 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
167 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
168 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
169 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
170 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
171 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
172 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
173 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
174 8023757577 Caballeronia peredens LP006 Isolate Coreidae
175 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
176 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
177 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
178 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
179 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
180 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
181 8100461708 Delftia sp. S65 Isolate Curculionidae
182 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
183 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
184 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
185 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
186 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
187 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
188 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
189 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_185429 3300042611 Bacteria 2534
2 Ga0466701_021367 3300042598 Bacteria 7743
3 Ga0466707_314669 3300042601 Bacteria 3667
4 Ga0466717_042457 3300042604 Bacteria 6340
5 Ga0123353_10252441 3300010167 Bacteria 2730
6 Ga0160471_102847 3300012812 Bacteria 2758
7 Ga0466730_060188 3300042625 Bacteria 807184
8 Ga0466730_092809 3300042625 Bacteria 164860
9 Ga0466703_098848 3300042636 Bacteria 35286
10 Ga0466724_23079 3300042649 Bacteria 108720
11 Ga0466724_53313 3300042649 Bacteria 7909
12 Ga0466708_211386 3300042652 Bacteria 11155
13 Ga0160470_103197 3300012813 Unclassified 2716
14 Ga0160452_100151 3300012834 Bacteria 81696
15 Ga0160472_101011 3300012839 Bacteria 10087
16 Ga0160447_107613 3300012849 Bacteria 2687
17 Ga0466656_092263 3300042550 Bacteria 1622
18 Ga0466657_378630 3300042582 Bacteria 5037
19 CVPL010W_10003800 3300002931 Bacteria 17152
20 Ga0068305_10081797 3300005083 Bacteria 4816
21 Ga0102736_1000387 3300007052 Bacteria 12461
22 Ga0466697_221683 3300042611 Bacteria 1184
23 Ga0466710_094155 3300042613 Bacteria 2600
24 Ga0466710_209788 3300042613 Bacteria 1701
25 Ga0466729_015267 3300042621 Bacteria 27681
26 Ga0466717_188118 3300042604 Bacteria 5072
27 Ga0123354_10083957 3300010882 Bacteria 4476
28 Ga0466708_451883 3300042652 Bacteria 3701
29 Ga0160441_100117 3300012825 Bacteria 90941
30 Ga0466657_400254 3300042582 Bacteria 44386
31 Ga0466690_252595 3300042590 Bacteria 114158
32 Ga0466695_178193 3300042595 Bacteria 6924
33 Ga0103263_102271 3300007042 Unclassified 2390
34 Ga0103266_1000032 3300007067 Bacteria 64254
35 Ga0103264_1000593 3300007188 Bacteria 17595
36 Ga0103264_1001882 3300007188 Bacteria 9320
37 Ga0466715_490816 3300042616 Bacteria 8932
38 Ga0466716_212395 3300042605 Bacteria 1838
39 Ga0466719_087637 3300042606 Bacteria 18430
40 Ga0123356_10710454 3300010049 Bacteria 1174
41 Ga0466734_014583 3300042623 Bacteria 2568
42 Ga0466734_077204 3300042623 Bacteria 6453
43 Ga0466704_258426 3300042643 Bacteria 95131
44 Ga0466725_070285 3300042654 Bacteria 5003
45 Ga0466725_221672 3300042654 Bacteria 17271
46 Ga0466727_312045 3300042655 Bacteria 91345
47 Ga0160456_101633 3300012820 Bacteria 5073
48 Ga0160459_100482 3300012831 Bacteria 15559
49 Ga0160460_103330 3300012845 Bacteria 2900
50 Ga0466690_384892 3300042590 Bacteria 29462
51 Ga0466695_101389 3300042595 Bacteria 6198
52 JGI24702J35022_10001638 3300002462 Unclassified 13879
53 CVPL005W_1000221 3300002934 Bacteria 27832
54 Ga0102737_1000444 3300007142 Bacteria 13636
55 Ga0104050_1004053 3300007153 Bacteria 3751
56 Ga0466710_244896 3300042613 Bacteria 5667
57 Ga0466710_361536 3300042613 Bacteria 65742
58 Ga0466715_405933 3300042616 Bacteria 6240
59 Ga0466723_030956 3300042618 Bacteria 22854
60 Ga0466701_022011 3300042598 Bacteria 293822
61 Ga0466701_047531 3300042598 Bacteria 58092
62 Ga0466735_052711 3300042624 Bacteria 1018
63 Ga0466703_083492 3300042636 Bacteria 13754
64 Ga0466708_405933 3300042652 Bacteria 43361
65 Ga0466725_193092 3300042654 Bacteria 188399
66 Ga0160470_102963 3300012813 Unclassified 2928
67 Ga0160436_1013566 3300012861 Unclassified 1696
68 Ga0466701_014839 3300042598 Bacteria 13676
69 JGI24702J35022_10201124 3300002462 Bacteria 1140
70 CVPL010W_10005960 3300002931 Bacteria 12756
71 Ga0068302_10005836 3300005071 Bacteria 8225
72 Ga0072941_1060739 3300005201 Bacteria 13051
73 Ga0072941_1368139 3300005201 Bacteria 2156
74 Ga0103265_1000822 3300007068 Bacteria 5169
75 Ga0102735_1000363 3300007080 Bacteria 10120
76 Ga0103268_1005977 3300007192 Bacteria 2467
77 Ga0466697_165727 3300042611 Bacteria 1410
78 Ga0466705_087780 3300042612 Bacteria 84355
79 Ga0466713_113603 3300042602 Bacteria 6492
80 Ga0466734_059668 3300042623 Unclassified 3847
81 Ga0466725_220958 3300042654 Bacteria 3526
82 Ga0160460_100865 3300012845 Bacteria 13201
83 Ga0466657_106717 3300042582 Bacteria 15889
84 Ga0466692_112515 3300042591 Bacteria 34783
85 Ga0466691_067007 3300042593 Bacteria 9418
86 IMNBGM34_c000040 3300000036 Bacteria 36196
87 CVPL010W_10009583 3300002931 Bacteria 14780
88 Ga0103266_1000947 3300007067 Bacteria 8986
89 Ga0102734_1000428 3300007129 Unclassified 12104
90 Ga0103260_1000688 3300007139 Bacteria 6392
91 Ga0102738_1000102 3300007141 Bacteria 29692
92 Ga0102737_1000440 3300007142 Bacteria 13699
93 Ga0466733_205194 3300042659 Bacteria 9389
94 Ga0466710_050553 3300042613 Bacteria 2201
95 Ga0466729_171304 3300042621 Bacteria 2918
96 Ga0466701_043885 3300042598 Bacteria 1387
97 Ga0466701_046794 3300042598 Bacteria 11223
98 Ga0466700_331720 3300042600 Bacteria 1899
99 Ga0123356_10663823 3300010049 Bacteria 1210
100 Ga0123354_10029377 3300010882 Bacteria 8649
101 Ga0466734_129327 3300042623 Bacteria 6125
102 Ga0466730_048744 3300042625 Bacteria 17324
103 Ga0466702_038601 3300042635 Bacteria 5149
104 Ga0466703_128094 3300042636 Bacteria 3957
105 Ga0466709_259679 3300042648 Bacteria 8373
106 Ga0466724_53791 3300042649 Bacteria 252935
107 Ga0466708_027360 3300042652 Bacteria 17977
108 Ga0466725_075035 3300042654 Unclassified 9241
109 Ga0160446_103943 3300012835 Unclassified 2263
110 Ga0466690_055909 3300042590 Bacteria 7335
111 Ga0466693_091732 3300042592 Bacteria 1939
112 CVPL010W_10018529 3300002931 Bacteria 8104
113 Ga0103267_1000719 3300007190 Bacteria 22558
114 Ga0103268_1000373 3300007192 Bacteria 14211
115 Ga0466697_208734 3300042611 Bacteria 2325
116 Ga0466733_006010 3300042659 Bacteria 31956
117 Ga0466710_244289 3300042613 Bacteria 14267
118 Ga0466711_004570 3300042615 Bacteria 28597
119 Ga0466715_004741 3300042616 Bacteria 2138
120 Ga0466718_165272 3300042617 Bacteria 1990
121 Ga0466697_016147 3300042611 Bacteria 1477
122 Ga0123354_10013287 3300010882 Bacteria 12773
123 Ga0466734_044633 3300042623 Bacteria 32831
124 Ga0466734_125925 3300042623 Bacteria 5175
125 Ga0466725_128143 3300042654 Bacteria 1524
126 Ga0160459_100087 3300012831 Unclassified 102976
127 Ga0466657_073959 3300042582 Bacteria 4029
128 Ga0466657_374101 3300042582 Unclassified 1005
129 Ga0466699_383030 3300042597 Bacteria 1121
130 CVPL005W_1000219 3300002934 Bacteria 25780
131 Ga0102738_1000389 3300007141 Bacteria 7623
132 Ga0105524_104511 3300007733 Bacteria 1864
133 Ga0123357_10000032 3300009784 Bacteria 114773
134 Ga0123357_10000237 3300009784 Bacteria 52445
135 Ga0466710_118073 3300042613 Bacteria 32374
136 Ga0466728_427893 3300042620 Bacteria 3492
137 Ga0466707_145704 3300042601 Bacteria 4607
138 Ga0466719_034349 3300042606 Bacteria 7307
139 Ga0466719_067936 3300042606 Bacteria 3647
140 Ga0466719_288480 3300042606 Bacteria 3648
141 Ga0466722_078699 3300042609 Bacteria 3837
142 Ga0123354_10000374 3300010882 Bacteria 42593
143 Ga0466708_142828 3300042652 Bacteria 17139
144 Ga0466725_237261 3300042654 Unclassified 3734
145 Ga0160447_103469 3300012849 Bacteria 5032
146 Ga0160430_103720 3300012852 Unclassified 4086
147 Ga0466657_251404 3300042582 Bacteria 1775
148 Ga0466657_257297 3300042582 Bacteria 2676
149 Ga0466657_280428 3300042582 Bacteria 4382
150 JGI24696J40584_12936215 3300002834 Unclassified 1576
151 Ga0072941_1126016 3300005201 Bacteria 6020
152 Ga0103264_1000197 3300007188 Bacteria 38500
153 Ga0103268_1000538 3300007192 Bacteria 11309

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_205194 Ga0466733_205194_3100_3861 240
2 3300042623 Ga0466734_129327 Ga0466734_129327_1368_2102 244
3 3300002931 CVPL010W_10009583 CVPL010W_100095834 245
4 3300007153 Ga0104050_1004053 Ga0104050_10040534 245
5 3300042623 Ga0466734_077204 Ga0466734_077204_2461_3198 245
6 3300042582 Ga0466657_073959 Ga0466657_073959_3265_4005 246
7 3300042582 Ga0466657_374101 Ga0466657_374101_71_811 246
8 3300042592 Ga0466693_091732 Ga0466693_091732_38_778 246
9 3300042598 Ga0466701_021367 Ga0466701_021367_6897_7637 246
10 3300042598 Ga0466701_046794 Ga0466701_046794_9975_10715 246
11 3300042598 Ga0466701_047531 Ga0466701_047531_17243_17983 246
12 3300042606 Ga0466719_288480 Ga0466719_288480_2469_3209 246
13 3300042611 Ga0466697_016147 Ga0466697_016147_84_824 246
14 3300042611 Ga0466697_221683 Ga0466697_221683_412_1152 246
15 3300042613 Ga0466710_361536 Ga0466710_361536_11772_12512 246
16 3300042623 Ga0466734_014583 Ga0466734_014583_205_945 246
17 3300042623 Ga0466734_044633 Ga0466734_044633_18658_19398 246
18 3300042623 Ga0466734_059668 Ga0466734_059668_1789_2529 246
19 3300042625 Ga0466730_060188 Ga0466730_060188_519628_520368 246
20 3300042649 Ga0466724_23079 Ga0466724_23079_13824_14564 246
21 3300042654 Ga0466725_075035 Ga0466725_075035_3131_3871 246
22 3300042654 Ga0466725_221672 Ga0466725_221672_4725_5465 246
23 iso_pr_bacteria 2528768159 2529054630 246
24 iso_pr_bacteria 2820084079 2820086159 246
25 iso_pr_bacteria 2820086750 2820089180 246
26 iso_pr_bacteria 2820152154 2820153153 246
27 iso_pr_bacteria 2848339753 2848340403 246
28 iso_pr_bacteria 2864826666 2864828370 246
29 iso_pr_bacteria 2864859030 2864859834 246
30 iso_pr_bacteria 2864914039 2864915131 246
31 iso_pr_bacteria 2864937364 2864941159 246
32 iso_pr_bacteria 2873565274 2873568818 246
33 iso_pr_bacteria 2873571580 2873572761 246
34 iso_pr_bacteria 8100449422 8100450704 246
35 iso_pr_bacteria 8100455565 8100458427 246
36 iso_pr_bacteria 8100461708 8100464032 246
37 3300005201 Ga0072941_1126016 Ga0072941_11260163 247
38 3300007080 Ga0102735_1000363 Ga0102735_10003633 247
39 3300007129 Ga0102734_1000428 Ga0102734_10004281 247
40 3300010167 Ga0123353_10252441 Ga0123353_102524412 247
41 3300010882 Ga0123354_10013287 Ga0123354_100132871 247
42 3300010882 Ga0123354_10029377 Ga0123354_100293777 247
43 3300012835 Ga0160446_103943 Ga0160446_1039432 247
44 3300042595 Ga0466695_178193 Ga0466695_178193_1991_2734 247
45 3300042597 Ga0466699_383030 Ga0466699_383030_161_904 247
46 3300042598 Ga0466701_022011 Ga0466701_022011_190504_191247 247
47 3300042601 Ga0466707_145704 Ga0466707_145704_1865_2608 247
48 3300042606 Ga0466719_087637 Ga0466719_087637_2963_3706 247
49 3300042613 Ga0466710_094155 Ga0466710_094155_421_1164 247
50 3300042613 Ga0466710_209788 Ga0466710_209788_208_951 247
51 3300042613 Ga0466710_244289 Ga0466710_244289_6038_6781 247
52 3300042613 Ga0466710_244896 Ga0466710_244896_3043_3786 247
53 3300042615 Ga0466711_004570 Ga0466711_004570_23272_24015 247
54 3300042623 Ga0466734_125925 Ga0466734_125925_3639_4382 247
55 3300042624 Ga0466735_052711 Ga0466735_052711_45_788 247
56 3300042625 Ga0466730_092809 Ga0466730_092809_102816_103559 247
57 3300042652 Ga0466708_405933 Ga0466708_405933_13769_14512 247
58 3300042654 Ga0466725_070285 Ga0466725_070285_3667_4410 247
59 iso_pr_bacteria 2864960361 2864961955 247
60 iso_pr_bacteria 2864968865 2864973239 247
61 iso_pr_bacteria 8024031916 8024034790 247
62 3300002931 CVPL010W_10005960 CVPL010W_100059606 248
63 3300005201 Ga0072941_1368139 Ga0072941_13681392 248
64 3300007042 Ga0103263_102271 Ga0103263_1022712 248
65 3300007067 Ga0103266_1000032 Ga0103266_10000323 248
66 3300007188 Ga0103264_1000197 Ga0103264_100019729 248
67 3300007188 Ga0103264_1001882 Ga0103264_10018825 248
68 3300007190 Ga0103267_1000719 Ga0103267_10007195 248
69 3300007192 Ga0103268_1000538 Ga0103268_100053815 248
70 3300007192 Ga0103268_1005977 Ga0103268_10059772 248
71 3300012813 Ga0160470_102963 Ga0160470_1029635 248
72 3300012813 Ga0160470_103197 Ga0160470_1031975 248
73 3300012825 Ga0160441_100117 Ga0160441_10011741 248
74 3300012831 Ga0160459_100087 Ga0160459_10008787 248
75 3300012845 Ga0160460_103330 Ga0160460_1033302 248
76 3300012852 Ga0160430_103720 Ga0160430_1037204 248
77 3300042582 Ga0466657_257297 Ga0466657_257297_166_912 248
78 3300042595 Ga0466695_101389 Ga0466695_101389_599_1345 248
79 3300042598 Ga0466701_014839 Ga0466701_014839_6687_7433 248
80 3300042604 Ga0466717_042457 Ga0466717_042457_873_1619 248
81 3300042604 Ga0466717_188118 Ga0466717_188118_1132_1878 248
82 3300042605 Ga0466716_212395 Ga0466716_212395_387_1133 248
83 3300042609 Ga0466722_078699 Ga0466722_078699_2056_2802 248
84 3300042611 Ga0466697_185429 Ga0466697_185429_463_1209 248
85 3300042613 Ga0466710_050553 Ga0466710_050553_788_1534 248
86 3300042635 Ga0466702_038601 Ga0466702_038601_2775_3521 248
87 3300042649 Ga0466724_53313 Ga0466724_53313_1287_2033 248
88 3300042654 Ga0466725_220958 Ga0466725_220958_405_1151 248
89 3300042654 Ga0466725_237261 Ga0466725_237261_1255_2001 248
90 3300042659 Ga0466733_006010 Ga0466733_006010_21224_21970 248
91 iso_pr_bacteria 2820050117 2820050549 248
92 iso_pr_bacteria 2820065746 2820067800 248
93 3300002931 CVPL010W_10003800 CVPL010W_100038009 249
94 3300005201 Ga0072941_1060739 Ga0072941_106073911 249
95 3300012812 Ga0160471_102847 Ga0160471_1028473 249
96 3300012820 Ga0160456_101633 Ga0160456_1016333 249
97 3300012839 Ga0160472_101011 Ga0160472_1010116 249
98 3300012845 Ga0160460_100865 Ga0160460_10086516 249
99 3300042550 Ga0466656_092263 Ga0466656_092263_35_784 249
100 3300042582 Ga0466657_106717 Ga0466657_106717_6925_7674 249
101 3300042582 Ga0466657_251404 Ga0466657_251404_401_1150 249
102 3300042582 Ga0466657_280428 Ga0466657_280428_547_1296 249
103 3300042582 Ga0466657_400254 Ga0466657_400254_36811_37560 249
104 3300042590 Ga0466690_384892 Ga0466690_384892_8226_8975 249
105 3300042593 Ga0466691_067007 Ga0466691_067007_3104_3853 249
106 3300042600 Ga0466700_331720 Ga0466700_331720_434_1183 249
107 3300042606 Ga0466719_067936 Ga0466719_067936_180_929 249
108 3300042611 Ga0466697_165727 Ga0466697_165727_495_1244 249
109 3300042612 Ga0466705_087780 Ga0466705_087780_81309_82058 249
110 3300042613 Ga0466710_118073 Ga0466710_118073_5100_5849 249
111 3300042616 Ga0466715_004741 Ga0466715_004741_209_958 249
112 3300042616 Ga0466715_405933 Ga0466715_405933_2002_2751 249
113 3300042616 Ga0466715_490816 Ga0466715_490816_4211_4960 249
114 3300042617 Ga0466718_165272 Ga0466718_165272_693_1442 249
115 3300042620 Ga0466728_427893 Ga0466728_427893_1103_1852 249
116 3300042621 Ga0466729_015267 Ga0466729_015267_3025_3774 249
117 3300042636 Ga0466703_083492 Ga0466703_083492_624_1373 249
118 3300042636 Ga0466703_098848 Ga0466703_098848_18176_18925 249
119 3300042636 Ga0466703_128094 Ga0466703_128094_1669_2418 249
120 3300042643 Ga0466704_258426 Ga0466704_258426_91960_92709 249
121 3300042652 Ga0466708_142828 Ga0466708_142828_2754_3503 249
122 3300042652 Ga0466708_211386 Ga0466708_211386_1135_1884 249
123 3300042652 Ga0466708_451883 Ga0466708_451883_632_1381 249
124 3300042654 Ga0466725_128143 Ga0466725_128143_488_1237 249
125 3300042654 Ga0466725_193092 Ga0466725_193092_171220_171969 249
126 3300042655 Ga0466727_312045 Ga0466727_312045_69286_70035 249
127 iso_pr_bacteria 2518285616 2518643006 249
128 iso_pr_bacteria 2820042117 2820043517 249
129 iso_pr_bacteria 2820089333 2820089601 249
130 iso_pr_bacteria 2891720358 2891723208 249
131 3300000036 IMNBGM34_c000040 IMNBGM34_00004016 250
132 3300002462 JGI24702J35022_10001638 JGI24702J35022_1000163813 250
133 3300002462 JGI24702J35022_10201124 JGI24702J35022_102011242 250
134 3300002834 JGI24696J40584_12936215 JGI24696J40584_129362152 250
135 3300002934 CVPL005W_1000221 CVPL005W_10002212 250
136 3300005071 Ga0068302_10005836 Ga0068302_1000583612 250
137 3300007052 Ga0102736_1000387 Ga0102736_100038715 250
138 3300007142 Ga0102737_1000444 Ga0102737_100044415 250
139 3300010882 Ga0123354_10000374 Ga0123354_100003749 250
140 3300010882 Ga0123354_10083957 Ga0123354_100839572 250
141 3300012849 Ga0160447_103469 Ga0160447_1034696 250
142 3300012849 Ga0160447_107613 Ga0160447_1076133 250
143 3300012861 Ga0160436_1013566 Ga0160436_10135662 250
144 3300042590 Ga0466690_055909 Ga0466690_055909_3135_3887 250
145 3300042590 Ga0466690_252595 Ga0466690_252595_79785_80537 250
146 3300042598 Ga0466701_043885 Ga0466701_043885_414_1166 250
147 3300042602 Ga0466713_113603 Ga0466713_113603_4468_5220 250
148 3300042611 Ga0466697_208734 Ga0466697_208734_927_1679 250
149 3300042625 Ga0466730_048744 Ga0466730_048744_15653_16405 250
150 3300042649 Ga0466724_53791 Ga0466724_53791_205343_206095 250
151 3300042652 Ga0466708_027360 Ga0466708_027360_12441_13193 250
152 iso_pr_bacteria 2597489944 2598058550 250
153 iso_pr_bacteria 2603880165 2606015792 250
154 iso_pr_bacteria 2820123897 2820125741 250
155 iso_pr_bacteria 3003869270 3003872288 250
156 iso_pr_bacteria 3003878002 3003881323 250
157 iso_pr_bacteria 8023724303 8023727732 250
158 iso_pr_bacteria 8023747282 8023750841 250
159 iso_pr_bacteria 8023752828 8023756910 250
160 iso_pr_bacteria 8023757577 8023761006 250
161 iso_pr_bacteria 8023764196 8023770072 250
162 iso_pr_bacteria 8024001094 8024003551 250
163 iso_pr_bacteria 8024014383 8024016730 250
164 iso_pr_bacteria 8024019580 8024019974 250
165 iso_pr_bacteria 8024025509 8024025865 250
166 iso_pr_bacteria 8024037630 8024040169 250
167 iso_pr_bacteria 8024044713 8024047171 250
168 iso_pr_bacteria 8025650824 8025653520 250
169 iso_pr_bacteria 8025658853 8025661628 250
170 iso_pr_bacteria 8025666332 8025668745 250
171 iso_pr_bacteria 8025671076 8025673554 250
172 iso_pr_bacteria 8025678175 8025680492 250
173 iso_pr_bacteria 8025685901 8025688969 250
174 iso_pr_bacteria 8025694439 8025697201 250
175 iso_pr_bacteria 8025701579 8025706346 250
176 iso_pr_bacteria 8025708040 8025710682 250
177 iso_pr_bacteria 8025716094 8025718976 250
178 iso_pr_bacteria 8025723035 8025725341 250
179 iso_pr_bacteria 8025728939 8025731670 250
180 iso_pr_bacteria 8025735396 8025736534 250
181 iso_pr_bacteria 8025740903 8025743278 250
182 iso_pr_bacteria 8025747911 8025750513 250
183 iso_pr_bacteria 8025756023 8025758625 250
184 iso_pr_bacteria 8069748016 8069749462 250
185 iso_pr_bacteria 8069755105 8069757707 250
186 iso_pr_bacteria 8069763219 8069765594 250
187 iso_pr_bacteria 8069770227 8069773786 250
188 iso_pr_bacteria 8069775773 8069779855 250
189 iso_pr_bacteria 8078130113 8078132590 250
190 iso_pr_bacteria 8101951471 8101953982 250
191 iso_pr_bacteria 8101960468 8101962980 250
192 iso_pr_bacteria 8101967387 8101969894 250
193 iso_pr_bacteria 8101974301 8101976815 250
194 iso_pr_bacteria 8101981714 8101984203 250
195 iso_pr_bacteria 8101988189 8101990721 250
196 iso_pr_bacteria 8101994502 8101997268 250
197 iso_pr_bacteria 8102001125 8102003462 250
198 iso_pr_bacteria 8102007614 8102010059 250
199 iso_pr_bacteria 8102014801 8102017254 250
200 iso_pr_bacteria 8102020860 8102023680 250
201 iso_pr_bacteria 8102026984 8102029572 250
202 iso_pr_bacteria 8102033761 8102036848 250
203 iso_pr_bacteria 8102041249 8102043683 250
204 iso_pr_bacteria 8102047609 8102050313 250
205 iso_pr_bacteria 8102054868 8102057305 250
206 iso_pr_bacteria 8102060671 8102063326 250
207 iso_pr_bacteria 8102067727 8102070233 250
208 iso_pr_bacteria 8102074813 8102077362 250
209 iso_pr_bacteria 8102081745 8102084284 250
210 iso_pr_bacteria 8102087471 8102089926 250
211 iso_pr_bacteria 8102094248 8102097088 250
212 iso_pr_bacteria 8102102351 8102104824 250
213 iso_pr_bacteria 8102109360 8102111897 250
214 iso_pr_bacteria 8102117041 8102119509 250
215 iso_pr_bacteria 8102124461 8102127128 250
216 iso_pr_bacteria 8102131453 8102136544 250
217 iso_pr_bacteria 8102138357 8102140864 250
218 iso_pr_bacteria 8102145433 8102148862 250
219 iso_pr_bacteria 8102152052 8102157928 250
220 iso_pr_bacteria 8102161003 8102167415 250
221 iso_pr_bacteria 8102169119 8102170257 250
222 iso_pr_bacteria 8102174626 8102177357 250
223 iso_pr_bacteria 8102181083 8102183389 250
224 iso_pr_bacteria 8102186987 8102189867 250
225 iso_pr_bacteria 8102193924 8102196565 250
226 iso_pr_bacteria 8102201977 8102206744 250
227 iso_pr_bacteria 8102208438 8102211134 250
228 iso_pr_bacteria 8102216467 8102219229 250
229 iso_pr_bacteria 8102223607 8102226085 250
230 iso_pr_bacteria 8102230706 8102233774 250
231 iso_pr_bacteria 8102239244 8102241560 250
232 iso_pr_bacteria 8102246966 8102249379 250
233 iso_pr_bacteria 8102251710 8102254485 250
234 iso_pr_bacteria 8102264549 8102267121 250
235 iso_pr_bacteria 8102271933 8102274606 250
236 iso_pr_bacteria 8102279326 8102281899 250
237 iso_pr_bacteria 8102286609 8102289265 250
238 iso_pr_bacteria 8102312426 8102314742 250
239 3300005083 Ga0068305_10081797 Ga0068305_100817975 251
240 3300009784 Ga0123357_10000032 Ga0123357_10000032102 251
241 3300012831 Ga0160459_100482 Ga0160459_1004826 251
242 3300012834 Ga0160452_100151 Ga0160452_10015182 251
243 3300042618 Ga0466723_030956 Ga0466723_030956_12492_13247 251
244 3300042648 Ga0466709_259679 Ga0466709_259679_4975_5730 251
245 3300002934 CVPL005W_1000219 CVPL005W_100021918 252
246 3300042621 Ga0466729_171304 Ga0466729_171304_500_1258 252
247 iso_pr_bacteria 2820121232 2820121620 252
248 3300007067 Ga0103266_1000947 Ga0103266_100094710 253
249 3300007141 Ga0102738_1000389 Ga0102738_10003895 253
250 3300009784 Ga0123357_10000237 Ga0123357_1000023736 253
251 3300010049 Ga0123356_10663823 Ga0123356_106638231 253
252 3300010049 Ga0123356_10710454 Ga0123356_107104541 253
253 3300042591 Ga0466692_112515 Ga0466692_112515_29864_30625 253
254 3300007139 Ga0103260_1000688 Ga0103260_10006882 254
255 3300042606 Ga0466719_034349 Ga0466719_034349_3279_4043 254
256 3300007068 Ga0103265_1000822 Ga0103265_10008223 256
257 3300007192 Ga0103268_1000373 Ga0103268_100037313 257
258 3300007188 Ga0103264_1000593 Ga0103264_10005933 258
259 3300042601 Ga0466707_314669 Ga0466707_314669_392_1168 258
260 iso_pr_bacteria 2864755708 2864760579 258
261 iso_pr_bacteria 2963630348 2963633762 258
262 iso_pr_bacteria 2603880172 2606035111 259
263 3300007142 Ga0102737_1000440 Ga0102737_10004408 260
264 3300007733 Ga0105524_104511 Ga0105524_1045112 262
265 3300002931 CVPL010W_10018529 CVPL010W_100185294 281
266 3300007141 Ga0102738_1000102 Ga0102738_100010211 284
267 3300042582 Ga0466657_378630 Ga0466657_378630_1030_1887 285

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00977 His_biosynth Histidine biosynthesis protein 40 269 0.99

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00977 GO:0000105 L-histidine biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.