Protein Family IF04427

Metagenome Isolate
200 Members
62 Samples
184 Scaffolds
188.15 Avg Length

🧬 Representative Sequence

ID
3300042582|Ga0466657_296737|Ga0466657_296737_639_1337
Length
232 aa
Sequence
LALAFSRWHKQVSEMPTTKRKTKYMHVAFGIGSFCHCQKLTAKATKMKYLIVGLGNIGPGYADTRHNIGFMVLDALAKASNTVFADKRYGFVAEIRLRNKQLVLLKPSTFMNLSGNAIRYWLQKENIPNENLLVVVDDLALPFGALRLKPKGSDAGHNGLRHIQDLIGQNYARLRFGIGSDFPRGHQSDYVLDAFSDEEQKVLPARIELAVDIIRSFCLAGVNVTMNQYNNK

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.1%
Kalotermitidae 23.0%
Blattidae 18.0%
Unclassified 9.8%
Rhinotermitidae 8.2%
Passalidae 3.3%
Termopsidae 3.3%
Hodotermitidae 1.6%
Drosophilidae 1.6%

🌳 Taxonomy

Archaea 2
Bacteria 187
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2922326829 Bacteroides sp. 224 Isolate Blattidae
10 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
11 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
17 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
18 3004672520 Bacteroides sp. 51 Isolate Blattidae
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
21 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
39 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
42 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
43 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
47 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
48 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
49 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
50 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
51 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
52 3004667792 Bacteroides sp. 519 Isolate Blattidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
59 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
60 3004677695 Bacteroides sp. 214 Isolate Blattidae
61 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
62 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_130937 3300042659 Bacteria 27936
2 Ga0466706_049207 3300042599 Bacteria 2529
3 Ga0466706_051152 3300042599 Bacteria 3563
4 Ga0466706_051504 3300042599 Bacteria 2116
5 Ga0466706_085954 3300042599 Bacteria 15828
6 Ga0466706_120308 3300042599 Bacteria 17593
7 Ga0466707_268584 3300042601 Bacteria 1087
8 Ga0466714_061367 3300042603 Bacteria 2284
9 2227660729 2225789004 Bacteria 10501
10 IMNBL1DRAFT_c0038470 3300000062 Bacteria 1644
11 JGI24695J34938_10361522 3300002450 Bacteria 640
12 JGI24699J35502_11133749 3300002509 Bacteria 14709
13 Ga0068305_10030449 3300005083 Bacteria 11001
14 Ga0104048_1172909 3300007143 Bacteria 1276
15 Ga0466710_212082 3300042613 Unclassified 6312
16 Ga0466723_238212 3300042618 Bacteria 5315
17 Ga0466690_259999 3300042590 Bacteria 17809
18 Ga0466692_151407 3300042591 Bacteria 4384
19 Ga0466729_299564 3300042621 Unclassified 1113
20 Ga0466735_229800 3300042624 Bacteria 5612
21 Ga0466703_225493 3300042636 Bacteria 10266
22 Ga0466705_052705 3300042612 Bacteria 20164
23 Ga0466732_447361 3300042656 Bacteria 66921
24 Ga0466733_084421 3300042659 Bacteria 1710
25 Ga0466706_056584 3300042599 Unclassified 12095
26 Ga0466706_078679 3300042599 Bacteria 8059
27 Ga0466706_163720 3300042599 Bacteria 10112
28 Ga0466706_241309 3300042599 Bacteria 1150
29 Ga0466713_064134 3300042602 Bacteria 51452
30 Ga0466722_227250 3300042609 Bacteria 1397
31 JGI24702J35022_10483939 3300002462 Bacteria 757
32 JGI24702J35022_10636322 3300002462 Bacteria 661
33 Ga0068305_10263788 3300005083 Bacteria 4561
34 Ga0466715_056997 3300042616 Bacteria 14431
35 Ga0466715_120738 3300042616 Bacteria 24996
36 Ga0466728_282666 3300042620 Bacteria 52404
37 Ga0265387_1003455 3300024582 Bacteria 2175
38 Ga0466692_012234 3300042591 Bacteria 21855
39 Ga0466692_202977 3300042591 Bacteria 25725
40 Ga0466691_000432 3300042593 Bacteria 39181
41 Ga0466696_202133 3300042596 Bacteria 4570
42 Ga0123357_10405874 3300009784 Bacteria 1234
43 Ga0466735_018809 3300042624 Bacteria 3340
44 Ga0466735_101028 3300042624 Bacteria 1107
45 Ga0466724_43113 3300042649 Bacteria 2979
46 Ga0466705_099969 3300042612 Bacteria 49190
47 Ga0466705_112896 3300042612 Bacteria 6237
48 Ga0466705_181557 3300042612 Bacteria 2940
49 Ga0466733_148277 3300042659 Bacteria 18385
50 Ga0466706_039990 3300042599 Bacteria 82239
51 Ga0466706_163974 3300042599 Bacteria 8219
52 Ga0466713_060620 3300042602 Bacteria 398690
53 Ga0466713_110965 3300042602 Bacteria 66281
54 Ga0466713_123775 3300042602 Bacteria 23789
55 Ga0466714_063465 3300042603 Bacteria 2454
56 Ga0466714_092453 3300042603 Bacteria 62724
57 Ga0466719_070992 3300042606 Bacteria 21195
58 Ga0068305_10073001 3300005083 Bacteria 12202
59 Ga0068305_10100602 3300005083 Bacteria 14088
60 Ga0466711_391486 3300042615 Bacteria 11141
61 Ga0123356_12070408 3300010049 Bacteria 710
62 Ga0466703_047396 3300042636 Archaea 1916
63 Ga0466704_079689 3300042643 Bacteria 8704
64 Ga0466709_159290 3300042648 Bacteria 18583
65 Ga0466727_250157 3300042655 Bacteria 1003
66 Ga0466705_305301 3300042612 Bacteria 1548
67 Ga0466733_136084 3300042659 Bacteria 48551
68 Ga0466706_251839 3300042599 Bacteria 10321
69 Ga0466713_054718 3300042602 Bacteria 26012
70 Ga0466714_026394 3300042603 Bacteria 5099
71 Ga0466714_122616 3300042603 Bacteria 3649
72 Ga0466714_143376 3300042603 Bacteria 3978
73 Ga0466714_169829 3300042603 Bacteria 1553
74 JGI24702J35022_10000192 3300002462 Bacteria 32902
75 Ga0466710_141431 3300042613 Unclassified 19401
76 Ga0466715_287610 3300042616 Bacteria 14683
77 Ga0466723_146492 3300042618 Bacteria 10019
78 Ga0466656_131898 3300042550 Bacteria 1202
79 Ga0466691_058842 3300042593 Bacteria 20577
80 Ga0466696_279917 3300042596 Bacteria 5356
81 Ga0123357_10152137 3300009784 Bacteria 2803
82 Ga0123356_10492705 3300010049 Bacteria 1380
83 Ga0123356_10707446 3300010049 Bacteria 1177
84 Ga0466704_292184 3300042643 Bacteria 18609
85 Ga0466709_094616 3300042648 Bacteria 182057
86 Ga0466709_363785 3300042648 Bacteria 41688
87 Ga0466727_282457 3300042655 Bacteria 2201
88 Ga0466705_041408 3300042612 Bacteria 14416
89 Ga0466705_135708 3300042612 Unclassified 2189
90 Ga0466732_298091 3300042656 Unclassified 2356
91 Ga0466733_008901 3300042659 Bacteria 5865
92 Ga0466733_038064 3300042659 Bacteria 7494
93 Ga0466733_040026 3300042659 Bacteria 8161
94 Ga0466706_014807 3300042599 Bacteria 31983
95 Ga0466707_043958 3300042601 Bacteria 9657
96 Ga0466707_103336 3300042601 Bacteria 10146
97 Ga0466713_088481 3300042602 Bacteria 9681
98 Ga0466713_094233 3300042602 Bacteria 2425
99 Ga0466714_015760 3300042603 Bacteria 1255
100 Ga0466714_043305 3300042603 Bacteria 2565
101 Ga0466714_099215 3300042603 Bacteria 6744
102 Ga0466714_154291 3300042603 Bacteria 5359
103 Ga0466722_261621 3300042609 Bacteria 3596
104 Ga0466711_027605 3300042615 Bacteria 6193
105 Ga0466711_141651 3300042615 Bacteria 4356
106 Ga0466715_142524 3300042616 Bacteria 16757
107 Ga0466692_028697 3300042591 Bacteria 10238
108 Ga0466696_142131 3300042596 Bacteria 3176
109 Ga0466696_179297 3300042596 Bacteria 26500
110 Ga0123353_12211157 3300010167 Bacteria 665
111 Ga0466735_068551 3300042624 Bacteria 2591
112 Ga0466735_163978 3300042624 Bacteria 2309
113 Ga0466703_040840 3300042636 Bacteria 1319
114 Ga0466703_327605 3300042636 Bacteria 2471
115 Ga0466704_481407 3300042643 Bacteria 6064
116 Ga0466727_243362 3300042655 Bacteria 1765
117 Ga0466733_003122 3300042659 Bacteria 3841
118 Ga0466733_176543 3300042659 Bacteria 2350
119 Ga0466706_057326 3300042599 Bacteria 4366
120 Ga0466706_063485 3300042599 Bacteria 4314
121 Ga0466706_134861 3300042599 Bacteria 19873
122 Ga0466706_175135 3300042599 Bacteria 1981
123 Ga0466714_100646 3300042603 Bacteria 1373
124 Ga0466714_146062 3300042603 Bacteria 3408
125 Ga0466716_034067 3300042605 Bacteria 12537
126 Ga0466716_330436 3300042605 Bacteria 29540
127 IMNBL1DRAFT_c0022807 3300000062 Bacteria 2468
128 JGI24702J35022_10033806 3300002462 Bacteria 2735
129 Ga0068305_10908044 3300005083 Bacteria 1071
130 Ga0466705_402854 3300042612 Bacteria 3978
131 Ga0466711_220778 3300042615 Unclassified 3573
132 Ga0466711_500392 3300042615 Bacteria 1645
133 Ga0265387_1001993 3300024582 Bacteria 2912
134 Ga0466657_296737 3300042582 Bacteria 1661
135 Ga0466690_188044 3300042590 Bacteria 53126
136 Ga0466696_212871 3300042596 Bacteria 2844
137 Ga0466735_039000 3300042624 Bacteria 1916
138 Ga0466708_024600 3300042652 Unclassified 3867
139 Ga0466708_130167 3300042652 Bacteria 53436
140 Ga0466697_172309 3300042611 Bacteria 15622
141 Ga0466733_026317 3300042659 Bacteria 3335
142 Ga0466733_114737 3300042659 Bacteria 3094
143 Ga0466733_118390 3300042659 Bacteria 16819
144 Ga0466733_147923 3300042659 Bacteria 1976
145 Ga0466733_183170 3300042659 Bacteria 1349
146 Ga0466706_180987 3300042599 Bacteria 7199
147 Ga0466707_288877 3300042601 Bacteria 1115
148 Ga0466713_045441 3300042602 Unclassified 3275
149 Ga0466714_070369 3300042603 Bacteria 2316
150 Ga0466714_084499 3300042603 Bacteria 1377
151 Ga0466714_092098 3300042603 Bacteria 5327
152 Ga0466714_111561 3300042603 Bacteria 28647
153 2227303006 2225789004 Bacteria 29397
154 JGI24702J35022_10011993 3300002462 Bacteria 4826
155 JGI24705J35276_12195860 3300002504 Bacteria 1531
156 Ga0466712_007983 3300042614 Bacteria 3026
157 Ga0265387_1065059 3300024582 Bacteria 689
158 Ga0466657_298022 3300042582 Bacteria 6364
159 Ga0466696_367343 3300042596 Bacteria 6569
160 Ga0123357_10148855 3300009784 Bacteria 2849
161 Ga0466725_398636 3300042654 Bacteria 2036
162 Ga0466727_335522 3300042655 Bacteria 3110
163 Ga0466701_073648 3300042598 Bacteria 2638
164 Ga0466706_232861 3300042599 Bacteria 10354
165 Ga0466707_006625 3300042601 Bacteria 19816
166 Ga0466707_100640 3300042601 Bacteria 8631
167 Ga0466713_059975 3300042602 Bacteria 22865
168 Ga0466714_009789 3300042603 Bacteria 1334
169 Ga0466714_128029 3300042603 Bacteria 1651
170 Ga0466714_156518 3300042603 Bacteria 2869
171 Ga0466722_049005 3300042609 Bacteria 3174
172 JGI24696J40584_12832329 3300002834 Archaea 933
173 Ga0068305_10434634 3300005083 Unclassified 2839
174 Ga0466711_106102 3300042615 Bacteria 9289
175 Ga0466711_158359 3300042615 Unclassified 3477
176 Ga0466728_012105 3300042620 Bacteria 1436
177 Ga0466696_082759 3300042596 Bacteria 10491
178 Ga0466735_002135 3300042624 Bacteria 3781
179 Ga0466735_044967 3300042624 Bacteria 5012
180 Ga0466735_049082 3300042624 Bacteria 1917
181 Ga0466735_162434 3300042624 Bacteria 2731
182 Ga0466704_223118 3300042643 Bacteria 11656
183 Ga0466704_354911 3300042643 Bacteria 15781
184 Ga0466708_031680 3300042652 Bacteria 4054

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_158359 Ga0466711_158359_25_501 158
2 3300042615 Ga0466711_220778 Ga0466711_220778_25_501 158
3 3300024582 Ga0265387_1001993 Ga0265387_10019932 172
4 3300042593 Ga0466691_058842 Ga0466691_058842_1740_2270 176
5 3300005083 Ga0068305_10263788 Ga0068305_102637882 184
6 3300042599 Ga0466706_134861 Ga0466706_134861_16567_17124 185
7 3300042612 Ga0466705_041408 Ga0466705_041408_683_1240 185
8 3300042615 Ga0466711_141651 Ga0466711_141651_486_1043 185
9 3300042624 Ga0466735_101028 Ga0466735_101028_91_648 185
10 3300042624 Ga0466735_229800 Ga0466735_229800_4276_4833 185
11 3300042643 Ga0466704_292184 Ga0466704_292184_1564_2121 185
12 3300002462 JGI24702J35022_10636322 JGI24702J35022_106363221 186
13 3300042590 Ga0466690_259999 Ga0466690_259999_684_1244 186
14 3300042596 Ga0466696_082759 Ga0466696_082759_3128_3688 186
15 3300042596 Ga0466696_142131 Ga0466696_142131_1698_2258 186
16 3300042596 Ga0466696_367343 Ga0466696_367343_4406_4966 186
17 3300042611 Ga0466697_172309 Ga0466697_172309_14359_14919 186
18 3300042613 Ga0466710_141431 Ga0466710_141431_5389_5949 186
19 3300042613 Ga0466710_212082 Ga0466710_212082_1771_2331 186
20 3300042616 Ga0466715_120738 Ga0466715_120738_21796_22356 186
21 3300042620 Ga0466728_012105 Ga0466728_012105_548_1108 186
22 3300042620 Ga0466728_282666 Ga0466728_282666_30061_30621 186
23 3300042648 Ga0466709_159290 Ga0466709_159290_12155_12715 186
24 3300042654 Ga0466725_398636 Ga0466725_398636_230_790 186
25 3300042659 Ga0466733_026317 Ga0466733_026317_2633_3193 186
26 iso_pr_bacteria 2940244548 2940246620 186
27 iso_pr_bacteria 2940248789 2940250804 186
28 iso_pr_bacteria 2940253009 2940254879 186
29 iso_pr_bacteria 2940257232 2940258938 186
30 2225789004 2227303006 2227753087 187
31 2225789004 2227660729 2228261158 187
32 3300005083 Ga0068305_10908044 Ga0068305_109080442 187
33 3300024582 Ga0265387_1003455 Ga0265387_10034552 187
34 3300024582 Ga0265387_1065059 Ga0265387_10650591 187
35 3300042550 Ga0466656_131898 Ga0466656_131898_439_1002 187
36 3300042582 Ga0466657_298022 Ga0466657_298022_3794_4357 187
37 3300042591 Ga0466692_012234 Ga0466692_012234_10677_11240 187
38 3300042591 Ga0466692_151407 Ga0466692_151407_2384_2947 187
39 3300042591 Ga0466692_202977 Ga0466692_202977_16736_17299 187
40 3300042593 Ga0466691_000432 Ga0466691_000432_21820_22383 187
41 3300042596 Ga0466696_202133 Ga0466696_202133_3544_4107 187
42 3300042596 Ga0466696_279917 Ga0466696_279917_625_1188 187
43 3300042599 Ga0466706_014807 Ga0466706_014807_28755_29318 187
44 3300042599 Ga0466706_039990 Ga0466706_039990_52380_52943 187
45 3300042599 Ga0466706_049207 Ga0466706_049207_267_830 187
46 3300042599 Ga0466706_051152 Ga0466706_051152_1655_2218 187
47 3300042599 Ga0466706_051504 Ga0466706_051504_1429_1992 187
48 3300042599 Ga0466706_063485 Ga0466706_063485_302_865 187
49 3300042599 Ga0466706_078679 Ga0466706_078679_3981_4544 187
50 3300042599 Ga0466706_085954 Ga0466706_085954_97_660 187
51 3300042599 Ga0466706_120308 Ga0466706_120308_16616_17179 187
52 3300042599 Ga0466706_163720 Ga0466706_163720_2698_3261 187
53 3300042599 Ga0466706_163974 Ga0466706_163974_4920_5483 187
54 3300042599 Ga0466706_175135 Ga0466706_175135_859_1422 187
55 3300042599 Ga0466706_180987 Ga0466706_180987_5867_6430 187
56 3300042599 Ga0466706_241309 Ga0466706_241309_188_751 187
57 3300042601 Ga0466707_006625 Ga0466707_006625_14408_14971 187
58 3300042601 Ga0466707_043958 Ga0466707_043958_6704_7267 187
59 3300042601 Ga0466707_103336 Ga0466707_103336_4905_5468 187
60 3300042601 Ga0466707_268584 Ga0466707_268584_503_1066 187
61 3300042601 Ga0466707_288877 Ga0466707_288877_62_625 187
62 3300042602 Ga0466713_045441 Ga0466713_045441_1512_2075 187
63 3300042602 Ga0466713_054718 Ga0466713_054718_707_1270 187
64 3300042602 Ga0466713_059975 Ga0466713_059975_3073_3636 187
65 3300042602 Ga0466713_064134 Ga0466713_064134_18725_19288 187
66 3300042602 Ga0466713_094233 Ga0466713_094233_634_1197 187
67 3300042602 Ga0466713_110965 Ga0466713_110965_4554_5117 187
68 3300042603 Ga0466714_009789 Ga0466714_009789_484_1047 187
69 3300042603 Ga0466714_015760 Ga0466714_015760_234_797 187
70 3300042603 Ga0466714_026394 Ga0466714_026394_3830_4393 187
71 3300042603 Ga0466714_043305 Ga0466714_043305_472_1035 187
72 3300042603 Ga0466714_061367 Ga0466714_061367_606_1169 187
73 3300042603 Ga0466714_063465 Ga0466714_063465_635_1198 187
74 3300042603 Ga0466714_070369 Ga0466714_070369_754_1317 187
75 3300042603 Ga0466714_084499 Ga0466714_084499_681_1244 187
76 3300042603 Ga0466714_092098 Ga0466714_092098_3352_3915 187
77 3300042603 Ga0466714_092453 Ga0466714_092453_58776_59339 187
78 3300042603 Ga0466714_099215 Ga0466714_099215_1912_2475 187
79 3300042603 Ga0466714_100646 Ga0466714_100646_405_968 187
80 3300042603 Ga0466714_122616 Ga0466714_122616_678_1241 187
81 3300042603 Ga0466714_128029 Ga0466714_128029_253_816 187
82 3300042603 Ga0466714_143376 Ga0466714_143376_2340_2903 187
83 3300042603 Ga0466714_146062 Ga0466714_146062_2382_2945 187
84 3300042603 Ga0466714_156518 Ga0466714_156518_1162_1725 187
85 3300042605 Ga0466716_034067 Ga0466716_034067_1591_2154 187
86 3300042612 Ga0466705_052705 Ga0466705_052705_7298_7861 187
87 3300042612 Ga0466705_305301 Ga0466705_305301_974_1537 187
88 3300042614 Ga0466712_007983 Ga0466712_007983_1244_1807 187
89 3300042615 Ga0466711_027605 Ga0466711_027605_753_1316 187
90 3300042616 Ga0466715_142524 Ga0466715_142524_7704_8267 187
91 3300042616 Ga0466715_287610 Ga0466715_287610_4491_5054 187
92 3300042618 Ga0466723_146492 Ga0466723_146492_8211_8774 187
93 3300042618 Ga0466723_238212 Ga0466723_238212_430_993 187
94 3300042621 Ga0466729_299564 Ga0466729_299564_48_611 187
95 3300042624 Ga0466735_044967 Ga0466735_044967_3657_4220 187
96 3300042636 Ga0466703_047396 Ga0466703_047396_937_1500 187
97 3300042636 Ga0466703_225493 Ga0466703_225493_8572_9135 187
98 3300042636 Ga0466703_327605 Ga0466703_327605_1533_2096 187
99 3300042643 Ga0466704_079689 Ga0466704_079689_8115_8678 187
100 3300042643 Ga0466704_223118 Ga0466704_223118_3717_4280 187
101 3300042643 Ga0466704_481407 Ga0466704_481407_4753_5316 187
102 3300042648 Ga0466709_094616 Ga0466709_094616_154222_154785 187
103 3300042648 Ga0466709_363785 Ga0466709_363785_3596_4159 187
104 3300042652 Ga0466708_130167 Ga0466708_130167_604_1167 187
105 3300042655 Ga0466727_243362 Ga0466727_243362_621_1184 187
106 3300042655 Ga0466727_250157 Ga0466727_250157_242_805 187
107 3300042655 Ga0466727_282457 Ga0466727_282457_626_1189 187
108 3300042655 Ga0466727_335522 Ga0466727_335522_1976_2539 187
109 3300042656 Ga0466732_298091 Ga0466732_298091_160_723 187
110 3300042656 Ga0466732_447361 Ga0466732_447361_45363_45926 187
111 3300042659 Ga0466733_003122 Ga0466733_003122_2378_2941 187
112 3300042659 Ga0466733_008901 Ga0466733_008901_3402_3965 187
113 3300042659 Ga0466733_038064 Ga0466733_038064_1202_1765 187
114 3300042659 Ga0466733_040026 Ga0466733_040026_2673_3236 187
115 3300042659 Ga0466733_084421 Ga0466733_084421_304_867 187
116 3300042659 Ga0466733_114737 Ga0466733_114737_1649_2212 187
117 3300042659 Ga0466733_118390 Ga0466733_118390_5192_5755 187
118 3300042659 Ga0466733_136084 Ga0466733_136084_38895_39458 187
119 3300042659 Ga0466733_148277 Ga0466733_148277_11600_12163 187
120 3300042659 Ga0466733_176543 Ga0466733_176543_1696_2259 187
121 3300042659 Ga0466733_183170 Ga0466733_183170_528_1091 187
122 iso_pr_bacteria 2695420931 2698111161 187
123 iso_pr_bacteria 2820757377 2820757815 187
124 iso_pr_bacteria 2910949487 2910952802 187
125 iso_pr_bacteria 2922326829 2922330595 187
126 iso_pr_bacteria 2940193328 2940194097 187
127 iso_pr_bacteria 2940336608 2940337373 187
128 iso_pr_bacteria 3004667792 3004670223 187
129 iso_pr_bacteria 3004672520 3004674798 187
130 iso_pr_bacteria 8100166142 8100170094 187
131 3300000062 IMNBL1DRAFT_c0022807 IMNBL1DRAFT_00228073 188
132 3300000062 IMNBL1DRAFT_c0038470 IMNBL1DRAFT_00384702 188
133 3300002462 JGI24702J35022_10011993 JGI24702J35022_100119932 188
134 3300002462 JGI24702J35022_10483939 JGI24702J35022_104839391 188
135 3300002509 JGI24699J35502_11133749 JGI24699J35502_111337497 188
136 3300005083 Ga0068305_10030449 Ga0068305_1003044911 188
137 3300005083 Ga0068305_10073001 Ga0068305_100730013 188
138 3300005083 Ga0068305_10100602 Ga0068305_101006022 188
139 3300005083 Ga0068305_10434634 Ga0068305_104346343 188
140 3300007143 Ga0104048_1172909 Ga0104048_11729092 188
141 3300010049 Ga0123356_10492705 Ga0123356_104927052 188
142 3300010049 Ga0123356_10707446 Ga0123356_107074462 188
143 3300042590 Ga0466690_188044 Ga0466690_188044_734_1300 188
144 3300042591 Ga0466692_028697 Ga0466692_028697_8467_9033 188
145 3300042598 Ga0466701_073648 Ga0466701_073648_1878_2444 188
146 3300042602 Ga0466713_060620 Ga0466713_060620_356403_356969 188
147 3300042602 Ga0466713_088481 Ga0466713_088481_312_878 188
148 3300042603 Ga0466714_111561 Ga0466714_111561_25220_25786 188
149 3300042603 Ga0466714_154291 Ga0466714_154291_1858_2424 188
150 3300042606 Ga0466719_070992 Ga0466719_070992_12383_12949 188
151 3300042609 Ga0466722_227250 Ga0466722_227250_310_876 188
152 3300042609 Ga0466722_261621 Ga0466722_261621_2346_2912 188
153 3300042615 Ga0466711_106102 Ga0466711_106102_2217_2783 188
154 3300042615 Ga0466711_391486 Ga0466711_391486_6868_7434 188
155 3300042615 Ga0466711_500392 Ga0466711_500392_794_1360 188
156 3300042616 Ga0466715_056997 Ga0466715_056997_10686_11252 188
157 3300042624 Ga0466735_068551 Ga0466735_068551_946_1512 188
158 3300042636 Ga0466703_040840 Ga0466703_040840_92_658 188
159 3300042643 Ga0466704_354911 Ga0466704_354911_13222_13788 188
160 3300042659 Ga0466733_130937 Ga0466733_130937_22878_23444 188
161 iso_pr_bacteria 3004677695 3004678942 188
162 3300002450 JGI24695J34938_10361522 JGI24695J34938_103615221 189
163 3300002462 JGI24702J35022_10000192 JGI24702J35022_100001923 189
164 3300002504 JGI24705J35276_12195860 JGI24705J35276_121958602 189
165 3300002834 JGI24696J40584_12832329 JGI24696J40584_128323292 189
166 3300009784 Ga0123357_10148855 Ga0123357_101488552 189
167 3300009784 Ga0123357_10152137 Ga0123357_101521374 189
168 3300009784 Ga0123357_10405874 Ga0123357_104058742 189
169 3300010049 Ga0123356_12070408 Ga0123356_120704082 189
170 3300010167 Ga0123353_12211157 Ga0123353_122111571 189
171 3300042596 Ga0466696_212871 Ga0466696_212871_1579_2148 189
172 3300042599 Ga0466706_056584 Ga0466706_056584_596_1165 189
173 3300042599 Ga0466706_057326 Ga0466706_057326_3348_3917 189
174 3300042599 Ga0466706_232861 Ga0466706_232861_8987_9556 189
175 3300042602 Ga0466713_123775 Ga0466713_123775_14570_15139 189
176 3300042652 Ga0466708_024600 Ga0466708_024600_756_1325 189
177 iso_pr_bacteria 2609459943 2610743278 189
178 iso_pr_bacteria 2830041218 2830041795 189
179 3300042624 Ga0466735_018809 Ga0466735_018809_63_635 190
180 3300042624 Ga0466735_049082 Ga0466735_049082_436_1008 190
181 3300042605 Ga0466716_330436 Ga0466716_330436_28859_29434 191
182 3300042624 Ga0466735_002135 Ga0466735_002135_2098_2676 192
183 3300042624 Ga0466735_039000 Ga0466735_039000_227_805 192
184 3300042624 Ga0466735_162434 Ga0466735_162434_1669_2247 192
185 3300042624 Ga0466735_163978 Ga0466735_163978_929_1507 192
186 3300042652 Ga0466708_031680 Ga0466708_031680_2607_3188 193
187 3300042659 Ga0466733_147923 Ga0466733_147923_80_700 194
188 3300042599 Ga0466706_251839 Ga0466706_251839_1308_1898 196
189 3300042612 Ga0466705_099969 Ga0466705_099969_44499_45092 197
190 3300042612 Ga0466705_112896 Ga0466705_112896_788_1381 197
191 3300042612 Ga0466705_135708 Ga0466705_135708_60_653 197
192 3300042612 Ga0466705_181557 Ga0466705_181557_788_1381 197
193 3300042649 Ga0466724_43113 Ga0466724_43113_2053_2649 198
194 3300042601 Ga0466707_100640 Ga0466707_100640_5882_6487 201
195 3300042603 Ga0466714_169829 Ga0466714_169829_213_827 204
196 3300042609 Ga0466722_049005 Ga0466722_049005_371_988 205
197 3300002462 JGI24702J35022_10033806 JGI24702J35022_100338064 207
198 3300042612 Ga0466705_402854 Ga0466705_402854_443_1087 214
199 3300042596 Ga0466696_179297 Ga0466696_179297_13631_14305 224
200 3300042582 Ga0466657_296737 Ga0466657_296737_639_1337 232

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase 50 230 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01195 GO:0004045 aminoacyl-tRNA hydrolase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.