Protein Family IF04397
Metagenome
Isolate
324
Members
250
Samples
138
Scaffolds
337.9
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_105038|Ga0466657_105038_3296_4423
- Length
- 375 aa
- Sequence
- MRMNFCTTTDIRQIMHPSSRVDAYLAVSSTGKERQMRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDSGARNVVVALREGSASARKAETEGLKVMGIAEAAAWCDLIMFTMPDELQAETYRKYVHDNLREGAAIAFAHGLNVHFGLIEPKKGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAVHQDASGKALEIGLSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLVELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVSGPRVLPYDETKARMKAVLRDIQTGKFVRDFMQENTVGQPFFKGTRRLNDEHQIERVGAKLREMMPWISKGKMVDRSRN
Sample Types
Isolate
57.4%
Metagenome
42.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
33.1%
Unclassified
19.4%
Termitidae
9.1%
Formicidae
8.3%
Elmidae
7.0%
Culicidae
4.1%
Curculionidae
3.7%
Armadillidiidae
2.1%
Kalotermitidae
2.1%
Apidae
1.2%
Nephropidae
0.8%
Scarabaeidae
0.8%
Berytidae
0.8%
Largidae
0.8%
Termopsidae
0.8%
Alydidae
0.8%
Drosophilidae
0.8%
Pediculidae
0.4%
Hodotermitidae
0.4%
Passalidae
0.4%
Tenebrionidae
0.4%
Trigoniulidae
0.4%
Crambidae
0.4%
Noctuidae
0.4%
Gryllidae
0.4%
Siricidae
0.4%
Cerambycidae
0.4%
Taxonomy
Archaea
0
Bacteria
290
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 2 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 3 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 4 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 5 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 6 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 7 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 8 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 9 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 10 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 11 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 12 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 13 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 14 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 15 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 21 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 22 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 23 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 24 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 25 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 26 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 27 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 28 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 29 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 30 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 31 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 32 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 33 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 34 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 35 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 36 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 37 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 38 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 39 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 40 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 41 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 42 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 43 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 44 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 49 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 50 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 53 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 54 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 55 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 60 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 61 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 62 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 63 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 64 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 65 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 66 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 67 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 68 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 69 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 70 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 71 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 72 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 73 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 74 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 75 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 76 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 77 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 78 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 79 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 80 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 81 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 82 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 83 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 84 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 85 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 86 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 87 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 88 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 89 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 90 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 91 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 92 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 93 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 94 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 95 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 96 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 97 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 98 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 99 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 100 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 101 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 102 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 103 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 104 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 105 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 106 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 107 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 108 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 109 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 110 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 111 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 112 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 113 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 114 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 115 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 116 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 117 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 118 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 119 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 120 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 121 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 122 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 123 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 124 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 125 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 126 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 127 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 128 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 129 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 130 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 131 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 132 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 133 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 134 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 135 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 136 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 137 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 138 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 139 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 140 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 141 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 142 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 143 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 144 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 145 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 146 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 147 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 148 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 149 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 150 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 151 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 152 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 153 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 154 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 155 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 156 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 157 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 158 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 159 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 160 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 161 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 162 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 163 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 164 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 165 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 166 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 167 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 168 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 169 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 170 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 171 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 172 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 173 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 174 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 175 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 176 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 177 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 178 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 179 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 180 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 181 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 182 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 183 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 184 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 185 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 186 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 187 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 188 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 189 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 190 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 191 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 192 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 193 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 194 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 195 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 196 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 197 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 198 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 199 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 200 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 201 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 202 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 203 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 204 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 205 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 206 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 207 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 208 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 209 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 210 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 211 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 212 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 213 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 214 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 215 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 216 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 217 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 218 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 219 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 220 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 221 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 222 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 223 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 224 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 225 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 226 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 227 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 228 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 229 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 230 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 231 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 232 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 233 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 234 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 235 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 236 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 237 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 238 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 239 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 240 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 241 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 242 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 243 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 244 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 245 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 246 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 247 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 248 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 249 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 250 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0103263_104312 | 3300007042 | Unclassified | 1662 |
| 2 | Ga0102735_1000017 | 3300007080 | Bacteria | 47721 |
| 3 | Ga0102739_1000271 | 3300007095 | Unclassified | 12277 |
| 4 | Ga0102734_1004457 | 3300007129 | Bacteria | 3144 |
| 5 | Ga0103264_1011041 | 3300007188 | Unclassified | 4679 |
| 6 | Ga0466731_073030 | 3300042622 | Bacteria | 1650 |
| 7 | Ga0466730_059748 | 3300042625 | Unclassified | 5964 |
| 8 | Ga0466727_012285 | 3300042655 | Bacteria | 78596 |
| 9 | Ga0160432_100637 | 3300012818 | Bacteria | 18981 |
| 10 | Ga0160446_100481 | 3300012835 | Bacteria | 17099 |
| 11 | Ga0160430_100338 | 3300012852 | Bacteria | 29678 |
| 12 | Ga0160435_1000580 | 3300012857 | Unclassified | 11163 |
| 13 | Ga0466699_228346 | 3300042597 | Bacteria | 1259 |
| 14 | SPBB_contig11545 | 2044078006 | Bacteria | 49416 |
| 15 | Meta3P_1005128 | 3300002464 | Bacteria | 17397 |
| 16 | CVPL010W_10004767 | 3300002931 | Bacteria | 14889 |
| 17 | CVPL005W_1000297 | 3300002934 | Bacteria | 21502 |
| 18 | CVPL005W_1000858 | 3300002934 | Unclassified | 10000 |
| 19 | CVPL005L_10008154 | 3300002938 | Bacteria | 9561 |
| 20 | Ga0103263_102303 | 3300007042 | Bacteria | 2373 |
| 21 | Ga0102736_1001309 | 3300007052 | Unclassified | 4402 |
| 22 | Ga0103260_1002420 | 3300007139 | Unclassified | 3154 |
| 23 | Ga0104019_1003835 | 3300007150 | Unclassified | 3055 |
| 24 | Ga0466727_293953 | 3300042655 | Bacteria | 80331 |
| 25 | Ga0466710_133629 | 3300042613 | Bacteria | 13845 |
| 26 | Ga0123357_10082108 | 3300009784 | Bacteria | 4234 |
| 27 | Ga0123354_10000003 | 3300010882 | Bacteria | 303062 |
| 28 | Ga0466701_039096 | 3300042598 | Bacteria | 1474 |
| 29 | Ga0466701_095979 | 3300042598 | Unclassified | 5322 |
| 30 | IMNBGM34_c004061 | 3300000036 | Bacteria | 1994 |
| 31 | HBC_ctgsDRAFT_1000131 | 3300000333 | Bacteria | 18177 |
| 32 | Ga0068302_10003620 | 3300005071 | Bacteria | 9613 |
| 33 | Ga0102736_1000825 | 3300007052 | Unclassified | 5794 |
| 34 | Ga0102740_1000638 | 3300007140 | Unclassified | 9576 |
| 35 | Ga0104019_1190532 | 3300007150 | Bacteria | 2313 |
| 36 | Ga0103268_1000046 | 3300007192 | Bacteria | 38573 |
| 37 | Ga0103268_1000719 | 3300007192 | Unclassified | 9433 |
| 38 | Ga0466724_48887 | 3300042649 | Bacteria | 71042 |
| 39 | Ga0123355_10467381 | 3300009826 | Bacteria | 1579 |
| 40 | Ga0123356_10046358 | 3300010049 | Unclassified | 4044 |
| 41 | Ga0160448_101930 | 3300012854 | Bacteria | 6591 |
| 42 | Ga0466694_045683 | 3300042594 | Unclassified | 8363 |
| 43 | Ga0466733_107427 | 3300042659 | Bacteria | 7007 |
| 44 | SWWA_contig32086__length_2542___numreads_48 | 2100351016 | Bacteria | 2542 |
| 45 | CVPL010W_10005768 | 3300002931 | Unclassified | 13050 |
| 46 | CVPL010W_10019824 | 3300002931 | Unclassified | 8191 |
| 47 | CVPL005W_1000829 | 3300002934 | Bacteria | 10288 |
| 48 | Ga0102734_1000243 | 3300007129 | Bacteria | 19556 |
| 49 | Ga0103264_1000839 | 3300007188 | Bacteria | 14016 |
| 50 | Ga0103264_1002698 | 3300007188 | Bacteria | 8048 |
| 51 | Ga0103268_1001006 | 3300007192 | Unclassified | 7551 |
| 52 | Ga0466730_102480 | 3300042625 | Bacteria | 16126 |
| 53 | Ga0466718_140747 | 3300042617 | Bacteria | 2924 |
| 54 | Ga0466718_156228 | 3300042617 | Bacteria | 5393 |
| 55 | Ga0123355_10070581 | 3300009826 | Bacteria | 5609 |
| 56 | Ga0160464_100067 | 3300012805 | Bacteria | 126353 |
| 57 | Ga0466701_018917 | 3300042598 | Bacteria | 69268 |
| 58 | Ga0466706_095588 | 3300042599 | Bacteria | 1877 |
| 59 | Ga0466713_113136 | 3300042602 | Bacteria | 8736 |
| 60 | Ga0160433_100090 | 3300012846 | Bacteria | 92891 |
| 61 | Ga0160445_109196 | 3300012847 | Bacteria | 1492 |
| 62 | Ga0160447_103513 | 3300012849 | Bacteria | 4991 |
| 63 | Ga0466701_001528 | 3300042598 | Bacteria | 84063 |
| 64 | Ga0466701_007469 | 3300042598 | Bacteria | 67864 |
| 65 | DPO_contig06422 | 2032320009 | Bacteria | 24155 |
| 66 | AglaG_contig22247 | 2084038013 | Bacteria | 1193 |
| 67 | SWWA_contig24617__length_18894___numreads_1179 | 2100351016 | Bacteria | 18894 |
| 68 | CVPL010W_10007847 | 3300002931 | Unclassified | 10326 |
| 69 | Ga0103265_1000565 | 3300007068 | Unclassified | 6297 |
| 70 | Ga0103265_1003404 | 3300007068 | Unclassified | 2353 |
| 71 | Ga0102738_1000318 | 3300007141 | Bacteria | 8710 |
| 72 | Ga0102737_1000143 | 3300007142 | Bacteria | 23200 |
| 73 | Ga0102737_1000898 | 3300007142 | Unclassified | 9005 |
| 74 | Ga0466709_213145 | 3300042648 | Unclassified | 6415 |
| 75 | Ga0466725_268318 | 3300042654 | Bacteria | 1938 |
| 76 | Ga0466727_072326 | 3300042655 | Bacteria | 142607 |
| 77 | Ga0466710_075475 | 3300042613 | Bacteria | 2077 |
| 78 | Ga0466710_278548 | 3300042613 | Unclassified | 1652 |
| 79 | Ga0466723_215682 | 3300042618 | Bacteria | 9598 |
| 80 | Ga0123353_10003668 | 3300010167 | Bacteria | 19484 |
| 81 | Ga0160460_100100 | 3300012845 | Bacteria | 119600 |
| 82 | Ga0160433_100245 | 3300012846 | Bacteria | 38489 |
| 83 | Ga0160435_1003866 | 3300012857 | Unclassified | 3507 |
| 84 | Ga0160436_1000322 | 3300012861 | Bacteria | 20808 |
| 85 | Ga0309901_1000019 | 3300028918 | Bacteria | 429099 |
| 86 | Ga0466657_092787 | 3300042582 | Bacteria | 3028 |
| 87 | Ga0466705_249352 | 3300042612 | Bacteria | 33232 |
| 88 | Ga0103266_1000335 | 3300007067 | Bacteria | 10980 |
| 89 | Ga0102737_1005749 | 3300007142 | Bacteria | 2436 |
| 90 | Ga0103264_1000341 | 3300007188 | Unclassified | 25042 |
| 91 | Ga0103264_1000811 | 3300007188 | Bacteria | 14375 |
| 92 | Ga0466704_341404 | 3300042643 | Bacteria | 18965 |
| 93 | Ga0466725_256630 | 3300042654 | Bacteria | 1167 |
| 94 | Ga0466710_058830 | 3300042613 | Bacteria | 6637 |
| 95 | Ga0123355_10148067 | 3300009826 | Bacteria | 3574 |
| 96 | Ga0466701_079388 | 3300042598 | Bacteria | 130298 |
| 97 | Ga0160455_100678 | 3300012837 | Bacteria | 14510 |
| 98 | Ga0466657_344010 | 3300042582 | Unclassified | 2315 |
| 99 | Ga0466705_216099 | 3300042612 | Bacteria | 18872 |
| 100 | FGTW_contig27632 | 2065487013 | Bacteria | 4273 |
| 101 | JGI24700J35501_10930883 | 3300002508 | Bacteria | 33786 |
| 102 | CVPL010W_10017786 | 3300002931 | Bacteria | 4560 |
| 103 | Ga0103266_1000501 | 3300007067 | Bacteria | 11921 |
| 104 | Ga0104045_1022541 | 3300007085 | Bacteria | 2086 |
| 105 | Ga0102737_1000309 | 3300007142 | Unclassified | 16580 |
| 106 | Ga0103264_1000225 | 3300007188 | Bacteria | 61623 |
| 107 | Ga0103264_1000237 | 3300007188 | Bacteria | 31419 |
| 108 | Ga0103264_1000253 | 3300007188 | Bacteria | 50442 |
| 109 | Ga0103267_1000393 | 3300007190 | Bacteria | 14550 |
| 110 | Ga0466734_071496 | 3300042623 | Bacteria | 1084 |
| 111 | Ga0466734_137353 | 3300042623 | Bacteria | 17585 |
| 112 | Ga0466724_45510 | 3300042649 | Bacteria | 6161 |
| 113 | Ga0466725_074171 | 3300042654 | Bacteria | 22500 |
| 114 | Ga0160464_100594 | 3300012805 | Bacteria | 23577 |
| 115 | Ga0466701_016944 | 3300042598 | Bacteria | 27083 |
| 116 | Ga0160456_100037 | 3300012820 | Bacteria | 206901 |
| 117 | Ga0160460_100161 | 3300012845 | Unclassified | 73805 |
| 118 | Ga0466657_105038 | 3300042582 | Bacteria | 9676 |
| 119 | Ga0530661_000440 | 3300056564 | Bacteria | 30932 |
| 120 | JGI24705J35276_12238280 | 3300002504 | Bacteria | 18478 |
| 121 | CVPL010W_10022058 | 3300002931 | Unclassified | 3440 |
| 122 | CVPL005W_1000255 | 3300002934 | Bacteria | 23120 |
| 123 | CVPL005L_10001713 | 3300002938 | Bacteria | 25296 |
| 124 | Ga0072941_1251062 | 3300005201 | Bacteria | 6579 |
| 125 | Ga0074278_141709 | 3300005721 | Bacteria | 3019 |
| 126 | Ga0103261_1001467 | 3300007083 | Unclassified | 3770 |
| 127 | Ga0102740_1000976 | 3300007140 | Bacteria | 11878 |
| 128 | Ga0102740_1002518 | 3300007140 | Unclassified | 4172 |
| 129 | Ga0103264_1000090 | 3300007188 | Bacteria | 60653 |
| 130 | Ga0466730_009578 | 3300042625 | Bacteria | 63640 |
| 131 | Ga0466724_36270 | 3300042649 | Bacteria | 39297 |
| 132 | Ga0466715_016648 | 3300042616 | Bacteria | 53064 |
| 133 | Ga0466715_319726 | 3300042616 | Bacteria | 63399 |
| 134 | Ga0160468_100001 | 3300012819 | Bacteria | 1115787 |
| 135 | Ga0160446_101142 | 3300012835 | Unclassified | 6362 |
| 136 | Ga0160460_101111 | 3300012845 | Unclassified | 10616 |
| 137 | Ga0466693_001942 | 3300042592 | Bacteria | 2190 |
| 138 | Ga0466695_179075 | 3300042595 | Bacteria | 9533 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07991 | IlvN | Acetohydroxy acid isomeroreductase, NADPH-binding domain | 49 | 213 | 0.99 |
| PF01450 | IlvC | Acetohydroxy acid isomeroreductase, catalytic domain | 219 | 363 | 0.99 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 53 | 125 | 0.84 |
| PF02826 | 2-Hacid_dh_C | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | 40 | 125 | 0.82 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02826 | GO:0051287 | NAD binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.