Protein Family IF04348

Metagenome Isolate
137 Members
48 Samples
129 Scaffolds
478.14 Avg Length

🧬 Representative Sequence

ID
3300041968|Ga0456237_0000577|Ga0456237_0000577_2339_4000
Length
547 aa
Sequence
MFFFLALRNISKNKKNSGIVALLIAVITFLFFIGNSVIGRADRGIREVYTDNLTGDVVIQKAGDVTMNLFGANTPIIDTYFTIPVLPAHDAVMELAAAEPGIAGITSQVSGKAYLDMMEVREPVLLCGVDAASYFSIFPGITLEEGRFLRAGEYGAMITLDRAERIERQTGQRPAIGTPMLFTAGGNAGFKIREVPLVGIFSYQNPGQFMNEIVIIDPQTVRVLNSIQVAGGADVELGEETLRLLAADPDDVFDDAAIFAADMTDNAEFSADTLQAYLSEFDLSESDGEIGGDWNFIILRLEKGVSPGSFISALNKKLAAYGVTAVSWRIAAGTSAILLLLIQSLFNAGVFLVSVAGVIAAINILLVAVFRRTREIGTLRAIGASDAYIRILILLENFLIALAAGFAGILFGLCFLRFINRMGIIIPNDLIASLLGGAVLQVELSPHIAGLSVMVAVILGAAASVYPVEIAVRIEPMAAVXXXXRLSIRWKSRCGLSLWRRCGGDDGKVFCPFQAGDKIFIPLPAALCVSFGGTGFWFCFPQRRDVG

📊 Sample Types

Isolate 5.8%
Metagenome 94.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.3%
Kalotermitidae 28.3%
Unclassified 17.4%
Rhinotermitidae 6.5%
Termopsidae 4.3%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 133
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
4 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
5 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
10 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
40 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
41 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_334362 3300042656 Bacteria 6080
2 Ga0466712_306462 3300042614 Bacteria 8550
3 Ga0466718_154608 3300042617 Bacteria 2906
4 Ga0466723_056745 3300042618 Bacteria 10718
5 Ga0466731_263901 3300042622 Bacteria 3467
6 Ga0466703_304504 3300042636 Bacteria 2810
7 Ga0466709_403353 3300042648 Bacteria 14900
8 Ga0466708_024501 3300042652 Bacteria 4521
9 Ga0264413_104284 3300024493 Bacteria 9049
10 Ga0456237_0000577 3300041968 Bacteria 5575
11 Ga0466690_082295 3300042590 Bacteria 3319
12 Ga0466691_039435 3300042593 Bacteria 20509
13 Ga0466700_196476 3300042600 Bacteria 1568
14 Ga0466719_279369 3300042606 Bacteria 9954
15 AustNasuHG_c1000958 3300000089 Bacteria 10425
16 AustNasuHG_c1010886 3300000089 Unclassified 3159
17 Ga0072940_1004615 3300005200 Bacteria 8291
18 Ga0072940_1004617 3300005200 Bacteria 6202
19 Ga0466705_007263 3300042612 Bacteria 40751
20 Ga0123357_10189918 3300009784 Bacteria 2370
21 Ga0466712_067544 3300042614 Bacteria 41898
22 Ga0466718_043842 3300042617 Bacteria 9656
23 Ga0466718_154969 3300042617 Bacteria 4084
24 Ga0466728_382517 3300042620 Bacteria 4307
25 Ga0466704_222603 3300042643 Bacteria 60546
26 Ga0466727_304517 3300042655 Bacteria 8046
27 Ga0264413_118676 3300024493 Bacteria 3027
28 Ga0264413_138267 3300024493 Bacteria 2345
29 Ga0466707_325394 3300042601 Bacteria 1778
30 AustNasuHG_c1001722 3300000089 Bacteria 7904
31 AustNasuHG_c1002941 3300000089 Bacteria 6134
32 Ga0072941_1023156 3300005201 Bacteria 7267
33 Ga0072941_1038484 3300005201 Bacteria 5484
34 Ga0466732_009972 3300042656 Bacteria 4028
35 Ga0466715_095569 3300042616 Bacteria 4794
36 Ga0466718_036118 3300042617 Bacteria 4945
37 Ga0466723_328083 3300042618 Bacteria 3197
38 Ga0466726_346816 3300042619 Bacteria 19893
39 Ga0466702_243783 3300042635 Bacteria 2510
40 Ga0466703_401770 3300042636 Bacteria 10081
41 Ga0264413_100367 3300024493 Bacteria 29796
42 Ga0466692_158416 3300042591 Bacteria 8550
43 Ga0466699_013067 3300042597 Bacteria 13318
44 Ga0466707_008155 3300042601 Bacteria 3541
45 JGI24698J34947_10004039 3300002449 Bacteria 7975
46 JGI24698J34947_10004366 3300002449 Bacteria 7693
47 JGI24698J34947_10019405 3300002449 Bacteria 3667
48 Ga0072941_1009244 3300005201 Bacteria 10446
49 Ga0072941_1171642 3300005201 Unclassified 5179
50 Ga0466732_028038 3300042656 Bacteria 10403
51 Ga0123356_10042379 3300010049 Bacteria 4240
52 Ga0466712_139760 3300042614 Bacteria 32143
53 Ga0466718_075255 3300042617 Bacteria 21483
54 Ga0466704_112416 3300042643 Bacteria 17765
55 Ga0466708_111468 3300042652 Bacteria 8897
56 Ga0466708_204572 3300042652 Bacteria 25955
57 Ga0466708_332078 3300042652 Bacteria 12009
58 Ga0264413_139567 3300024493 Bacteria 4832
59 Ga0466694_034023 3300042594 Bacteria 6000
60 Ga0072941_1021659 3300005201 Bacteria 6805
61 Ga0466732_042592 3300042656 Bacteria 6024
62 Ga0466732_071295 3300042656 Bacteria 4503
63 Ga0123353_10284374 3300010167 Bacteria 2537
64 Ga0466712_029124 3300042614 Bacteria 12816
65 Ga0466712_098031 3300042614 Bacteria 43056
66 Ga0466715_028817 3300042616 Bacteria 9460
67 Ga0466715_067011 3300042616 Bacteria 9228
68 Ga0466715_246457 3300042616 Bacteria 9146
69 Ga0466723_118108 3300042618 Bacteria 8565
70 Ga0466723_213427 3300042618 Bacteria 16725
71 Ga0466726_024971 3300042619 Bacteria 5276
72 Ga0466703_151649 3300042636 Bacteria 6348
73 Ga0466709_256871 3300042648 Bacteria 26995
74 Ga0466708_284999 3300042652 Bacteria 28094
75 Ga0264413_105979 3300024493 Bacteria 7443
76 Ga0466692_188035 3300042591 Bacteria 4821
77 Ga0466693_224631 3300042592 Bacteria 9393
78 Ga0466691_150092 3300042593 Bacteria 13824
79 JGI24698J34947_10003004 3300002449 Bacteria 9142
80 Ga0466705_013545 3300042612 Bacteria 34726
81 Ga0466705_324122 3300042612 Bacteria 22195
82 Ga0123355_10001012 3300009826 Bacteria 38990
83 Ga0466712_069703 3300042614 Bacteria 18452
84 Ga0466712_096948 3300042614 Bacteria 13734
85 Ga0466712_223592 3300042614 Bacteria 5084
86 Ga0466711_142820 3300042615 Bacteria 35097
87 Ga0466715_131531 3300042616 Bacteria 3277
88 Ga0466715_133837 3300042616 Bacteria 11157
89 Ga0466718_083674 3300042617 Bacteria 23117
90 Ga0264413_112960 3300024493 Bacteria 13089
91 Ga0466690_086451 3300042590 Bacteria 9224
92 Ga0466691_047978 3300042593 Bacteria 9754
93 Ga0466716_362076 3300042605 Bacteria 22472
94 Ga0466720_178452 3300042607 Bacteria 61615
95 Ga0466722_135992 3300042609 Bacteria 2372
96 JGI24698J34947_10009196 3300002449 Bacteria 5422
97 JGI24698J34947_10017592 3300002449 Unclassified 3872
98 JGI24700J35501_10929315 3300002508 Bacteria 9029
99 Ga0072940_1017890 3300005200 Bacteria 10977
100 Ga0072941_1101721 3300005201 Bacteria 5376
101 Ga0466705_352169 3300042612 Bacteria 3426
102 Ga0123353_10488427 3300010167 Bacteria 1799
103 Ga0466715_016153 3300042616 Bacteria 4931
104 Ga0466704_077441 3300042643 Bacteria 25921
105 Ga0466709_228858 3300042648 Bacteria 27396
106 Ga0264413_105820 3300024493 Bacteria 10451
107 Ga0264413_114720 3300024493 Bacteria 4172
108 Ga0466690_121045 3300042590 Bacteria 74235
109 Ga0466691_063439 3300042593 Bacteria 8495
110 Ga0466691_185422 3300042593 Bacteria 12554
111 Ga0466716_517915 3300042605 Bacteria 12969
112 Ga0466720_108024 3300042607 Bacteria 60869
113 AustNasuHG_c1002524 3300000089 Bacteria 6628
114 JGI24698J34947_10001287 3300002449 Unclassified 13139
115 Ga0466732_216647 3300042656 Bacteria 8635
116 Ga0123353_10475176 3300010167 Bacteria 1831
117 Ga0466715_410796 3300042616 Bacteria 6692
118 Ga0466718_002524 3300042617 Bacteria 42896
119 Ga0466718_041811 3300042617 Bacteria 20555
120 Ga0466703_046739 3300042636 Bacteria 28227
121 Ga0466703_229778 3300042636 Bacteria 8159
122 Ga0264413_104325 3300024493 Bacteria 24047
123 Ga0264413_115040 3300024493 Bacteria 6159
124 Ga0466694_214517 3300042594 Bacteria 32563
125 Ga0466695_221990 3300042595 Bacteria 77793
126 Ga0466707_414681 3300042601 Bacteria 6085
127 Ga0466722_223293 3300042609 Bacteria 3111
128 JGI24698J34947_10000132 3300002449 Bacteria 27417
129 Ga0072941_1023157 3300005201 Bacteria 3353

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1017890 Ga0072940_10178907 440
2 3300000089 AustNasuHG_c1001722 AustNasuHG_10017224 441
3 3300042617 Ga0466718_154969 Ga0466718_154969_526_2025 448
4 3300002449 JGI24698J34947_10004039 JGI24698J34947_100040393 450
5 3300042605 Ga0466716_517915 Ga0466716_517915_9075_10475 451
6 3300042591 Ga0466692_158416 Ga0466692_158416_1614_2972 452
7 3300042597 Ga0466699_013067 Ga0466699_013067_1911_3350 452
8 3300042600 Ga0466700_196476 Ga0466700_196476_30_1472 452
9 3300042614 Ga0466712_223592 Ga0466712_223592_267_1709 452
10 3300000089 AustNasuHG_c1000958 AustNasuHG_10009585 453
11 3300042590 Ga0466690_121045 Ga0466690_121045_69106_70467 453
12 3300042619 Ga0466726_346816 Ga0466726_346816_8630_10096 458
13 iso_pr_bacteria 2781125685 2781418243 458
14 3300042617 Ga0466718_083674 Ga0466718_083674_6906_8357 459
15 3300042619 Ga0466726_024971 Ga0466726_024971_3550_4956 459
16 3300002508 JGI24700J35501_10929315 JGI24700J35501_109293155 460
17 3300024493 Ga0264413_114720 Ga0264413_1147204 463
18 3300000089 AustNasuHG_c1010886 AustNasuHG_10108862 465
19 3300042648 Ga0466709_228858 Ga0466709_228858_21097_22551 465
20 3300042652 Ga0466708_111468 Ga0466708_111468_1506_2993 465
21 iso_pr_bacteria 2819994798 2819995972 465
22 3300024493 Ga0264413_105979 Ga0264413_1059794 467
23 3300042617 Ga0466718_036118 Ga0466718_036118_2204_3667 467
24 3300042617 Ga0466718_154608 Ga0466718_154608_1279_2742 467
25 3300010167 Ga0123353_10284374 Ga0123353_102843742 468
26 3300024493 Ga0264413_100367 Ga0264413_10036721 468
27 3300024493 Ga0264413_105820 Ga0264413_1058202 468
28 3300024493 Ga0264413_139567 Ga0264413_1395672 468
29 3300042636 Ga0466703_304504 Ga0466703_304504_816_2273 468
30 3300005201 Ga0072941_1038484 Ga0072941_10384844 469
31 3300042607 Ga0466720_108024 Ga0466720_108024_52672_54123 470
32 3300042616 Ga0466715_410796 Ga0466715_410796_3780_5279 470
33 3300042618 Ga0466723_213427 Ga0466723_213427_11697_13145 470
34 3300042656 Ga0466732_071295 Ga0466732_071295_2053_3501 470
35 3300042594 Ga0466694_034023 Ga0466694_034023_4043_5509 472
36 3300042617 Ga0466718_075255 Ga0466718_075255_5388_6839 472
37 3300042618 Ga0466723_328083 Ga0466723_328083_146_1603 472
38 3300009826 Ga0123355_10001012 Ga0123355_1000101217 473
39 3300042614 Ga0466712_139760 Ga0466712_139760_6765_8222 473
40 3300002449 JGI24698J34947_10019405 JGI24698J34947_100194052 474
41 3300042593 Ga0466691_039435 Ga0466691_039435_6574_8115 475
42 3300042636 Ga0466703_229778 Ga0466703_229778_5932_7401 476
43 3300042643 Ga0466704_222603 Ga0466704_222603_11681_13150 477
44 3300042648 Ga0466709_256871 Ga0466709_256871_18137_19603 477
45 3300002449 JGI24698J34947_10009196 JGI24698J34947_100091964 478
46 3300042648 Ga0466709_403353 Ga0466709_403353_2571_4007 478
47 iso_pr_bacteria 2781125639 2781286470 478
48 iso_pr_bacteria 2781125690 2781427308 478
49 3300000089 AustNasuHG_c1002524 AustNasuHG_10025243 479
50 3300000089 AustNasuHG_c1002941 AustNasuHG_10029415 479
51 3300042601 Ga0466707_414681 Ga0466707_414681_1546_2985 479
52 3300042615 Ga0466711_142820 Ga0466711_142820_3905_5377 479
53 3300042591 Ga0466692_188035 Ga0466692_188035_358_1800 480
54 3300042614 Ga0466712_029124 Ga0466712_029124_7350_8792 480
55 3300042614 Ga0466712_067544 Ga0466712_067544_15361_16803 480
56 iso_pr_bacteria 2781125632 2781270886 480
57 iso_pr_bacteria 2781125655 2781317280 480
58 3300002449 JGI24698J34947_10000132 JGI24698J34947_100001323 481
59 3300002449 JGI24698J34947_10001287 JGI24698J34947_100012874 481
60 3300002449 JGI24698J34947_10003004 JGI24698J34947_100030045 481
61 3300005201 Ga0072941_1101721 Ga0072941_11017215 481
62 3300042612 Ga0466705_013545 Ga0466705_013545_1539_2984 481
63 3300042616 Ga0466715_067011 Ga0466715_067011_2702_4147 481
64 3300042620 Ga0466728_382517 Ga0466728_382517_2714_4159 481
65 3300005201 Ga0072941_1023156 Ga0072941_10231565 482
66 3300005201 Ga0072941_1023157 Ga0072941_10231572 482
67 3300024493 Ga0264413_104284 Ga0264413_1042845 482
68 3300024493 Ga0264413_115040 Ga0264413_1150403 482
69 3300042593 Ga0466691_150092 Ga0466691_150092_9615_11063 482
70 3300042606 Ga0466719_279369 Ga0466719_279369_6219_7667 482
71 3300042614 Ga0466712_096948 Ga0466712_096948_9347_10795 482
72 3300042614 Ga0466712_098031 Ga0466712_098031_29866_31314 482
73 3300042616 Ga0466715_028817 Ga0466715_028817_5530_6978 482
74 3300042616 Ga0466715_095569 Ga0466715_095569_2729_4207 482
75 3300042622 Ga0466731_263901 Ga0466731_263901_416_1864 482
76 3300042635 Ga0466702_243783 Ga0466702_243783_387_1835 482
77 3300042636 Ga0466703_151649 Ga0466703_151649_2322_3770 482
78 3300042643 Ga0466704_077441 Ga0466704_077441_14354_15802 482
79 3300042656 Ga0466732_028038 Ga0466732_028038_7363_8811 482
80 3300002449 JGI24698J34947_10017592 JGI24698J34947_100175922 483
81 3300005201 Ga0072941_1009244 Ga0072941_10092446 483
82 3300005201 Ga0072941_1021659 Ga0072941_10216593 483
83 3300009784 Ga0123357_10189918 Ga0123357_101899182 483
84 3300010049 Ga0123356_10042379 Ga0123356_100423793 483
85 3300010167 Ga0123353_10475176 Ga0123353_104751762 483
86 3300024493 Ga0264413_118676 Ga0264413_1186762 483
87 3300042590 Ga0466690_086451 Ga0466690_086451_5755_7206 483
88 3300042593 Ga0466691_185422 Ga0466691_185422_4018_5469 483
89 3300042594 Ga0466694_214517 Ga0466694_214517_13492_14943 483
90 3300042605 Ga0466716_362076 Ga0466716_362076_6143_7645 483
91 3300042609 Ga0466722_135992 Ga0466722_135992_748_2199 483
92 3300042609 Ga0466722_223293 Ga0466722_223293_177_1628 483
93 3300042614 Ga0466712_306462 Ga0466712_306462_5097_6548 483
94 3300042616 Ga0466715_016153 Ga0466715_016153_3439_4890 483
95 3300042618 Ga0466723_118108 Ga0466723_118108_2014_3465 483
96 3300042656 Ga0466732_334362 Ga0466732_334362_1642_3093 483
97 iso_pr_bacteria 2781125681 2781407967 483
98 3300002449 JGI24698J34947_10004366 JGI24698J34947_100043665 484
99 3300005200 Ga0072940_1004615 Ga0072940_10046155 484
100 3300005200 Ga0072940_1004617 Ga0072940_10046172 484
101 3300042612 Ga0466705_007263 Ga0466705_007263_4253_5734 484
102 3300042652 Ga0466708_284999 Ga0466708_284999_16562_18016 484
103 3300042655 Ga0466727_304517 Ga0466727_304517_6061_7515 484
104 iso_pr_bacteria 2772190975 2773721104 484
105 3300042607 Ga0466720_178452 Ga0466720_178452_32081_33538 485
106 3300042612 Ga0466705_324122 Ga0466705_324122_6953_8410 485
107 3300042618 Ga0466723_056745 Ga0466723_056745_573_2030 485
108 3300042643 Ga0466704_112416 Ga0466704_112416_3082_4539 485
109 3300042656 Ga0466732_042592 Ga0466732_042592_2220_3698 485
110 3300010167 Ga0123353_10488427 Ga0123353_104884272 486
111 3300042593 Ga0466691_047978 Ga0466691_047978_7975_9435 486
112 3300042593 Ga0466691_063439 Ga0466691_063439_1604_3064 486
113 3300042595 Ga0466695_221990 Ga0466695_221990_50325_51785 486
114 3300042601 Ga0466707_325394 Ga0466707_325394_168_1628 486
115 3300042612 Ga0466705_352169 Ga0466705_352169_1849_3309 486
116 3300042656 Ga0466732_009972 Ga0466732_009972_2319_3779 486
117 3300024493 Ga0264413_112960 Ga0264413_1129602 487
118 3300024493 Ga0264413_138267 Ga0264413_1382672 487
119 3300042601 Ga0466707_008155 Ga0466707_008155_1673_3136 487
120 3300042652 Ga0466708_024501 Ga0466708_024501_1085_2584 488
121 3300042652 Ga0466708_332078 Ga0466708_332078_8748_10214 488
122 3300024493 Ga0264413_104325 Ga0264413_10432518 489
123 3300005201 Ga0072941_1171642 Ga0072941_11716425 490
124 3300042616 Ga0466715_133837 Ga0466715_133837_3484_4956 490
125 3300042636 Ga0466703_046739 Ga0466703_046739_16492_17964 490
126 3300042652 Ga0466708_204572 Ga0466708_204572_6721_8193 490
127 3300042617 Ga0466718_043842 Ga0466718_043842_4355_5830 491
128 3300042616 Ga0466715_246457 Ga0466715_246457_5847_7505 492
129 3300042614 Ga0466712_069703 Ga0466712_069703_2368_3879 493
130 3300042617 Ga0466718_041811 Ga0466718_041811_3217_4698 493
131 3300042616 Ga0466715_131531 Ga0466715_131531_1206_2690 494
132 3300042617 Ga0466718_002524 Ga0466718_002524_7568_9052 494
133 3300042656 Ga0466732_216647 Ga0466732_216647_3681_5165 494
134 3300042590 Ga0466690_082295 Ga0466690_082295_816_2303 495
135 3300042592 Ga0466693_224631 Ga0466693_224631_4445_5947 500
136 3300042636 Ga0466703_401770 Ga0466703_401770_3986_5503 500
137 3300041968 Ga0456237_0000577 Ga0456237_0000577_2339_4000 547

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02687 FtsX FtsX-like permease family 350 476 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02687 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.