Protein Family IF04333

Metagenome Isolate
153 Members
75 Samples
117 Scaffolds
276.93 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_171127|Ga0415639_171127_6744_7685
Length
313 aa
Sequence
MLYTRRRRTHQIFREFFRTKNSKKGEDYMLKEIMARKKQDITDSRATTGKKGEVKVDIPADMFVKCTDCGRSIYRKEMQSLHNSCPNCNKLFRLSAKARVDLVTDEGSFQELDIKVERKNPLNFPEYDAKLDKAEKASGLKEAVLCGECKIEGSRAIICVMDSHFMMGSMGSAVGEYLATAFEVATARRLPIVIFTASGGARMQEGIVSLMQMAKVSGALAAHSEEGLLYITVLTDPTTGGVTASFASLGDIILAEKGALIGFAGRRVIEQTIRQKLPSDFQSAEFLLEKGFVDAIVDRSNQKEVIGKILSMH

📊 Sample Types

Isolate 23.5%
Metagenome 76.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 19.2%
Termitidae 17.8%
Unclassified 15.1%
Pyralidae 6.8%
Elmidae 5.5%
Termopsidae 5.5%
Scarabaeidae 4.1%
Rhinotermitidae 4.1%
Tenebrionidae 2.7%
Bombycidae 2.7%
Hodotermitidae 1.4%
Passalidae 1.4%
Curculionidae 1.4%
Portunidae 1.4%
Drosophilidae 1.4%
Ocypodidae 1.4%
Gomphidae 1.4%
Nephropidae 1.4%
Noctuidae 1.4%
Hydrophilidae 1.4%
Eresidae 1.4%
Culicidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864801025 Bacillus aerius S00042 Isolate Elmidae
2 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
3 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
4 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
5 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
6 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
7 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
8 2590828839 Clostridium sp. 1 Isolate Termitidae
9 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
10 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2537562000 Bacillus cereus HD73 Isolate Pyralidae
19 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
29 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
34 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
35 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
36 2969145278 Bacillus cereus 29 Isolate Portunidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
39 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
40 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
41 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
42 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
43 2864909992 Bacillus velezensis S00166 Isolate Elmidae
44 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
51 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
56 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
57 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
58 2978778678 Bacillus cereus 25 Isolate Ocypodidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
61 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
62 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
63 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
66 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
67 2864895409 Bacillus aerius S00152 Isolate Elmidae
68 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
69 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
70 8022725327 Bacillus sp. SN10 Isolate Eresidae
71 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
72 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
73 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
74 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
75 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_010259 3300042599 Bacteria 63363
2 Ga0466706_183178 3300042599 Bacteria 15497
3 Ga0466719_075170 3300042606 Bacteria 3615
4 Ga0466735_118830 3300042624 Bacteria 14931
5 Ga0466735_122109 3300042624 Bacteria 4311
6 Ga0466727_117004 3300042655 Bacteria 1167
7 Ga0123357_10003787 3300009784 Bacteria 17500
8 Ga0123357_10241696 3300009784 Bacteria 1953
9 Ga0466715_112554 3300042616 Bacteria 31031
10 Ga0466728_410586 3300042620 Bacteria 34706
11 Ga0466690_048357 3300042590 Bacteria 10256
12 Ga0466705_321631 3300042612 Bacteria 270475
13 Ga0466706_121376 3300042599 Bacteria 9389
14 Ga0466707_406882 3300042601 Bacteria 34507
15 Ga0466735_050144 3300042624 Bacteria 25386
16 Ga0466735_072616 3300042624 Bacteria 10087
17 Ga0466735_130546 3300042624 Bacteria 11044
18 Ga0466735_166143 3300042624 Bacteria 3663
19 Ga0466730_059705 3300042625 Unclassified 1406
20 Ga0466727_077915 3300042655 Bacteria 1804
21 Ga0123355_10371202 3300009826 Unclassified 1874
22 Ga0123353_10281312 3300010167 Bacteria 2555
23 Ga0123353_10312745 3300010167 Unclassified 2389
24 Ga0466715_028990 3300042616 Bacteria 46691
25 Ga0466723_373944 3300042618 Unclassified 28303
26 Ga0466726_152326 3300042619 Bacteria 13437
27 Ga0068305_10000195 3300005083 Bacteria 118813
28 Ga0415639_013994 3300038395 Bacteria 2328
29 Ga0466691_107875 3300042593 Bacteria 13249
30 Ga0466733_201569 3300042659 Bacteria 4515
31 Ga0562379_0003 3300056790 Bacteria 3011780
32 Ga0466700_093272 3300042600 Bacteria 1080
33 Ga0466716_305704 3300042605 Bacteria 9495
34 Ga0466735_029557 3300042624 Bacteria 17303
35 Ga0466730_083014 3300042625 Bacteria 4219
36 Ga0466704_582126 3300042643 Bacteria 7730
37 Ga0466727_151432 3300042655 Bacteria 242508
38 Ga0123355_10669986 3300009826 Bacteria 1203
39 Ga0466715_372841 3300042616 Bacteria 11287
40 Ga0466728_066684 3300042620 Bacteria 35223
41 Ga0466729_101185 3300042621 Bacteria 22730
42 Ga0063521_1000278 3300003973 Unclassified 32708
43 Ga0466691_225685 3300042593 Bacteria 109994
44 Ga0466696_331233 3300042596 Bacteria 2942
45 Ga0466706_006636 3300042599 Bacteria 217881
46 Ga0466707_158829 3300042601 Bacteria 178149
47 Ga0466707_288884 3300042601 Bacteria 5359
48 Ga0466713_005286 3300042602 Bacteria 50542
49 Ga0466704_270701 3300042643 Bacteria 11717
50 Ga0466726_071206 3300042619 Bacteria 1197
51 Ga0466728_437045 3300042620 Bacteria 11081
52 Ga0466729_016754 3300042621 Bacteria 37408
53 IMNBL1DRAFT_c0004552 3300000062 Bacteria 8278
54 Ga0466690_243346 3300042590 Bacteria 1480
55 Ga0466691_076994 3300042593 Bacteria 7333
56 Ga0466719_442134 3300042606 Bacteria 13292
57 Ga0466735_004060 3300042624 Bacteria 13967
58 Ga0466735_166239 3300042624 Unclassified 1732
59 Ga0466735_175982 3300042624 Bacteria 10392
60 Ga0466709_368785 3300042648 Bacteria 33804
61 Ga0466724_06301 3300042649 Bacteria 2830
62 Ga0123355_10194147 3300009826 Bacteria 2981
63 Ga0123355_10330058 3300009826 Bacteria 2045
64 Ga0466705_392935 3300042612 Bacteria 18153
65 Ga0466726_022795 3300042619 Bacteria 6027
66 Ga0415639_208632 3300038395 Bacteria 1951
67 Ga0466690_355270 3300042590 Bacteria 9568
68 Ga0466733_202131 3300042659 Bacteria 1435
69 Ga0466706_019380 3300042599 Bacteria 325727
70 Ga0466706_174674 3300042599 Bacteria 11411
71 Ga0466707_410434 3300042601 Bacteria 14526
72 Ga0466719_421316 3300042606 Bacteria 10005
73 Ga0466722_182394 3300042609 Bacteria 2438
74 Ga0466735_033290 3300042624 Bacteria 13180
75 Ga0466704_364740 3300042643 Unclassified 57997
76 Ga0466708_007154 3300042652 Bacteria 5661
77 Ga0123356_10050609 3300010049 Bacteria 3865
78 Ga0123353_10041769 3300010167 Bacteria 7249
79 Ga0466711_117944 3300042615 Bacteria 215972
80 Ga0466711_228583 3300042615 Bacteria 4031
81 Ga0466723_260843 3300042618 Unclassified 28535
82 Ga0466726_158471 3300042619 Bacteria 35402
83 Ga0466726_378994 3300042619 Bacteria 129768
84 Ga0466728_329025 3300042620 Bacteria 9692
85 Ga0068305_10000253 3300005083 Bacteria 49207
86 Ga0466713_044417 3300042602 Bacteria 52236
87 Ga0466735_128854 3300042624 Bacteria 31221
88 Ga0466735_229643 3300042624 Unclassified 5306
89 Ga0466703_046544 3300042636 Bacteria 38951
90 Ga0466703_244879 3300042636 Bacteria 60768
91 Ga0466708_211014 3300042652 Bacteria 28441
92 Ga0466708_254181 3300042652 Bacteria 6707
93 Ga0123356_10101250 3300010049 Bacteria 2764
94 Ga0466726_009564 3300042619 Bacteria 101360
95 Ga0466726_072424 3300042619 Bacteria 11909
96 Ga0466726_370296 3300042619 Bacteria 3590
97 Ga0466728_205591 3300042620 Bacteria 48931
98 Ga0466728_374130 3300042620 Bacteria 101360
99 Ga0466729_069876 3300042621 Bacteria 5687
100 Ga0068302_10396413 3300005071 Unclassified 3815
101 Ga0415639_073670 3300038395 Bacteria 1487
102 Ga0415639_171127 3300038395 Bacteria 9672
103 Ga0466696_178183 3300042596 Bacteria 12729
104 Ga0466706_271952 3300042599 Bacteria 8558
105 Ga0466707_312703 3300042601 Bacteria 49252
106 Ga0466707_416679 3300042601 Bacteria 126598
107 Ga0466702_450433 3300042635 Bacteria 2521
108 Ga0466704_570609 3300042643 Bacteria 26629
109 Ga0466725_437607 3300042654 Bacteria 1721
110 Ga0123355_10570883 3300009826 Bacteria 1357
111 Ga0123353_10010830 3300010167 Bacteria 12765
112 Ga0466723_192931 3300042618 Bacteria 2183
113 Ga0466726_165557 3300042619 Bacteria 12979
114 2211830539 2209111004 Bacteria 32177
115 Ga0068302_10128122 3300005071 Bacteria 4159
116 Ga0068305_10000187 3300005083 Bacteria 96943
117 Ga0415639_052828 3300038395 Bacteria 3230

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_158829 Ga0466707_158829_86257_87060 247
2 3300042643 Ga0466704_270701 Ga0466704_270701_5565_6311 248
3 3300042619 Ga0466726_152326 Ga0466726_152326_7671_8486 252
4 3300042601 Ga0466707_406882 Ga0466707_406882_17766_18572 253
5 3300042624 Ga0466735_130546 Ga0466735_130546_9249_10049 253
6 3300010049 Ga0123356_10050609 Ga0123356_100506094 254
7 3300042616 Ga0466715_028990 Ga0466715_028990_16555_17379 254
8 3300042618 Ga0466723_373944 Ga0466723_373944_4505_5329 254
9 3300042601 Ga0466707_410434 Ga0466707_410434_12740_13552 256
10 3300042620 Ga0466728_205591 Ga0466728_205591_6800_7612 256
11 3300042624 Ga0466735_128854 Ga0466735_128854_21612_22427 256
12 3300042615 Ga0466711_117944 Ga0466711_117944_166105_166923 257
13 3300042624 Ga0466735_229643 Ga0466735_229643_842_1648 257
14 3300042636 Ga0466703_244879 Ga0466703_244879_23923_24747 257
15 3300042659 Ga0466733_201569 Ga0466733_201569_1140_2003 258
16 3300042590 Ga0466690_355270 Ga0466690_355270_3988_4812 259
17 3300042606 Ga0466719_442134 Ga0466719_442134_4456_5280 259
18 3300042616 Ga0466715_372841 Ga0466715_372841_4690_5514 259
19 3300042620 Ga0466728_066684 Ga0466728_066684_4649_5473 259
20 3300042643 Ga0466704_364740 Ga0466704_364740_8023_8847 259
21 3300042648 Ga0466709_368785 Ga0466709_368785_4470_5294 259
22 3300042636 Ga0466703_046544 Ga0466703_046544_28742_29524 260
23 3300042643 Ga0466704_582126 Ga0466704_582126_1618_2439 260
24 3300042599 Ga0466706_121376 Ga0466706_121376_2191_2979 262
25 3300042599 Ga0466706_006636 Ga0466706_006636_104377_105207 263
26 3300042599 Ga0466706_174674 Ga0466706_174674_5108_5902 264
27 3300042616 Ga0466715_112554 Ga0466715_112554_14612_15424 264
28 3300042599 Ga0466706_019380 Ga0466706_019380_49279_50076 265
29 3300042620 Ga0466728_329025 Ga0466728_329025_2585_3382 265
30 3300042593 Ga0466691_225685 Ga0466691_225685_93168_93992 266
31 3300042596 Ga0466696_178183 Ga0466696_178183_2434_3234 266
32 3300042615 Ga0466711_228583 Ga0466711_228583_219_1019 266
33 3300042624 Ga0466735_033290 Ga0466735_033290_2862_3662 266
34 3300042593 Ga0466691_076994 Ga0466691_076994_5546_6349 267
35 3300042612 Ga0466705_321631 Ga0466705_321631_199037_199840 267
36 3300042619 Ga0466726_009564 Ga0466726_009564_12956_13759 267
37 3300042652 Ga0466708_211014 Ga0466708_211014_14268_15071 267
38 3300042655 Ga0466727_151432 Ga0466727_151432_102763_103566 267
39 iso_pr_bacteria 2820261600 2820261681 267
40 3300042599 Ga0466706_271952 Ga0466706_271952_3210_4073 268
41 3300042602 Ga0466713_005286 Ga0466713_005286_24140_24946 268
42 3300042602 Ga0466713_044417 Ga0466713_044417_24013_24819 268
43 3300042619 Ga0466726_022795 Ga0466726_022795_3459_4265 268
44 3300042624 Ga0466735_004060 Ga0466735_004060_8455_9261 268
45 3300042624 Ga0466735_029557 Ga0466735_029557_15467_16273 268
46 3300042624 Ga0466735_072616 Ga0466735_072616_1318_2124 268
47 3300042624 Ga0466735_122109 Ga0466735_122109_2513_3319 268
48 3300042624 Ga0466735_166143 Ga0466735_166143_1823_2629 268
49 3300042624 Ga0466735_166239 Ga0466735_166239_755_1561 268
50 3300042655 Ga0466727_117004 Ga0466727_117004_186_992 268
51 3300005083 Ga0068305_10000195 Ga0068305_1000019531 269
52 3300005083 Ga0068305_10000253 Ga0068305_1000025324 269
53 3300042606 Ga0466719_421316 Ga0466719_421316_1125_1934 269
54 3300042621 Ga0466729_016754 Ga0466729_016754_14870_15679 269
55 3300042659 Ga0466733_202131 Ga0466733_202131_411_1265 270
56 3300005071 Ga0068302_10396413 Ga0068302_103964133 271
57 3300042596 Ga0466696_331233 Ga0466696_331233_1912_2727 271
58 3300042605 Ga0466716_305704 Ga0466716_305704_4336_5151 271
59 3300042612 Ga0466705_392935 Ga0466705_392935_11585_12400 271
60 3300042618 Ga0466723_260843 Ga0466723_260843_23658_24473 271
61 3300042619 Ga0466726_165557 Ga0466726_165557_4763_5578 271
62 3300042620 Ga0466728_374130 Ga0466728_374130_4490_5305 271
63 3300042624 Ga0466735_050144 Ga0466735_050144_13584_14399 271
64 3300005083 Ga0068305_10000187 Ga0068305_100001878 272
65 3300009784 Ga0123357_10003787 Ga0123357_100037874 272
66 3300042590 Ga0466690_048357 Ga0466690_048357_41_859 272
67 3300042601 Ga0466707_288884 Ga0466707_288884_2735_3553 272
68 3300042619 Ga0466726_158471 Ga0466726_158471_7273_8130 273
69 3300042621 Ga0466729_069876 Ga0466729_069876_846_1667 273
70 3300042619 Ga0466726_370296 Ga0466726_370296_416_1240 274
71 iso_pr_bacteria 642555172 642791280 274
72 3300042621 Ga0466729_101185 Ga0466729_101185_21149_21976 275
73 3300042643 Ga0466704_570609 Ga0466704_570609_5061_5888 275
74 3300042654 Ga0466725_437607 Ga0466725_437607_400_1278 275
75 3300042652 Ga0466708_007154 Ga0466708_007154_678_1508 276
76 iso_pr_bacteria 2820721785 2820722372 276
77 3300010167 Ga0123353_10010830 Ga0123353_100108304 277
78 3300010167 Ga0123353_10312745 Ga0123353_103127453 277
79 3300042609 Ga0466722_182394 Ga0466722_182394_1309_2148 279
80 3300042601 Ga0466707_312703 Ga0466707_312703_20971_21813 280
81 3300042619 Ga0466726_378994 Ga0466726_378994_68632_69474 280
82 3300042625 Ga0466730_083014 Ga0466730_083014_458_1300 280
83 3300038395 Ga0415639_208632 Ga0415639_208632_76_981 281
84 3300042624 Ga0466735_175982 Ga0466735_175982_6904_7794 281
85 3300009826 Ga0123355_10371202 Ga0123355_103712022 282
86 3300038395 Ga0415639_013994 Ga0415639_013994_667_1572 282
87 3300042619 Ga0466726_071206 Ga0466726_071206_17_865 282
88 iso_pr_bacteria 2820046858 2820047160 282
89 3300009784 Ga0123357_10241696 Ga0123357_102416963 283
90 3300010049 Ga0123356_10101250 Ga0123356_101012503 283
91 3300010167 Ga0123353_10041769 Ga0123353_100417695 283
92 3300010167 Ga0123353_10281312 Ga0123353_102813122 283
93 3300038395 Ga0415639_052828 Ga0415639_052828_765_1673 283
94 3300042590 Ga0466690_243346 Ga0466690_243346_387_1238 283
95 iso_pr_bacteria 643886090 644663541 283
96 3300042635 Ga0466702_450433 Ga0466702_450433_1528_2382 284
97 3300042652 Ga0466708_254181 Ga0466708_254181_1310_2164 284
98 iso_pr_bacteria 2820075487 2820076271 284
99 3300009826 Ga0123355_10330058 Ga0123355_103300582 285
100 iso_pr_bacteria 2873581347 2873583758 286
101 3300009826 Ga0123355_10570883 Ga0123355_105708832 287
102 3300042618 Ga0466723_192931 Ga0466723_192931_977_1840 287
103 3300042620 Ga0466728_410586 Ga0466728_410586_14747_15610 287
104 3300042624 Ga0466735_118830 Ga0466735_118830_1602_2465 287
105 3300042625 Ga0466730_059705 Ga0466730_059705_364_1227 287
106 3300042649 Ga0466724_06301 Ga0466724_06301_53_916 287
107 3300042620 Ga0466728_437045 Ga0466728_437045_5764_6630 288
108 3300042655 Ga0466727_077915 Ga0466727_077915_586_1452 288
109 iso_pr_bacteria 2585428141 2588053453 288
110 iso_pr_bacteria 8018798118 8018799337 288
111 iso_pr_bacteria 8018802046 8018804138 288
112 3300009826 Ga0123355_10194147 Ga0123355_101941472 289
113 3300009826 Ga0123355_10669986 Ga0123355_106699862 289
114 3300042606 Ga0466719_075170 Ga0466719_075170_709_1578 289
115 3300056790 Ga0562379_0003 Ga0562379_0003_546480_547349 289
116 iso_pr_bacteria 2537562000 2539433920 289
117 iso_pr_bacteria 2563367190 2565787106 289
118 iso_pr_bacteria 2767802234 2769331622 289
119 iso_pr_bacteria 2822232166 2822235797 289
120 iso_pr_bacteria 2822450720 2822454400 289
121 iso_pr_bacteria 2864782175 2864783849 289
122 iso_pr_bacteria 2912849059 2912853799 289
123 iso_pr_bacteria 2969145278 2969147511 289
124 iso_pr_bacteria 2978778678 2978781940 289
125 iso_pr_bacteria 643886085 644681981 289
126 iso_pr_bacteria 643886087 644669598 289
127 iso_pr_bacteria 643886091 644650665 289
128 iso_pr_bacteria 8012942269 8012942720 289
129 iso_pr_bacteria 8022725327 8022727179 289
130 iso_pr_bacteria 8022781829 8022783681 289
131 iso_pr_bacteria 8061039349 8061044666 289
132 iso_pr_bacteria 8061045771 8061049458 289
133 iso_pr_bacteria 8061100935 8061104773 289
134 2209111004 2211830539 2211865612 290
135 3300000062 IMNBL1DRAFT_c0004552 IMNBL1DRAFT_00045522 290
136 3300003973 Ga0063521_1000278 Ga0063521_10002787 290
137 iso_pr_bacteria 2791355481 2794424955 290
138 iso_pr_bacteria 2864909992 2864913001 290
139 iso_pr_bacteria 8064531044 8064534103 290
140 3300042593 Ga0466691_107875 Ga0466691_107875_7848_8723 291
141 3300042600 Ga0466700_093272 Ga0466700_093272_126_1001 291
142 3300042601 Ga0466707_416679 Ga0466707_416679_33647_34522 291
143 iso_pr_bacteria 2574180310 2576357944 291
144 iso_pr_bacteria 2590828839 2593253192 291
145 iso_pr_bacteria 2864801025 2864803261 291
146 iso_pr_bacteria 2864895409 2864897643 291
147 iso_pr_bacteria 8043041867 8043042033 291
148 3300042599 Ga0466706_010259 Ga0466706_010259_48599_49477 292
149 3300042619 Ga0466726_072424 Ga0466726_072424_828_1706 292
150 3300005071 Ga0068302_10128122 Ga0068302_101281222 298
151 3300038395 Ga0415639_171127 Ga0415639_171127_6744_7685 313
152 3300038395 Ga0415639_073670 Ga0415639_073670_54_1010 318
153 3300042599 Ga0466706_183178 Ga0466706_183178_9682_10722 346

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01039 Carboxyl_trans Carboxyl transferase domain 96 273 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.