Protein Family IF04324

Metagenome Isolate
156 Members
35 Samples
133 Scaffolds
142.92 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_111674|Ga0415639_111674_7007_7510
Length
167 aa
Sequence
MESGDIIAKLNVKLPDDFLDKISRLGEKTDDIVPRVLQAGAGVVLAKVKSNLQAAIGKDTKYESRSTGELISAVGISPVKVDKNGNHNLKVGFREPRSDGGSNARIANVLEHGSSTQPARPFLKPAKSATREPCKDAMIQALESELNLAGGSTEHNRNQYIQWRNGG

📊 Sample Types

Isolate 1.3%
Metagenome 98.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.2%
Kalotermitidae 26.5%
Unclassified 11.8%
Passalidae 5.9%
Rhinotermitidae 5.9%
Tenebrionidae 2.9%
Hodotermitidae 2.9%
Termopsidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 31

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
9 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10012767 3300009826 Bacteria 13028
2 Ga0123356_10312002 3300010049 Bacteria 1682
3 Ga0123356_12834009 3300010049 Bacteria 607
4 Ga0123353_10799625 3300010167 Bacteria 1302
5 Ga0123353_11244800 3300010167 Bacteria 972
6 Ga0466711_219529 3300042615 Bacteria 8238
7 Ga0415639_101313 3300038395 Bacteria 2515
8 Ga0415639_111674 3300038395 Unclassified 11920
9 Ga0466706_220490 3300042599 Bacteria 222739
10 Ga0466713_079928 3300042602 Bacteria 1560
11 Ga0466703_275711 3300042636 Unclassified 6403
12 Ga0123355_10108289 3300009826 Bacteria 4351
13 Ga0123355_10208317 3300009826 Bacteria 2840
14 Ga0123355_10619075 3300009826 Bacteria 1277
15 Ga0123356_10993869 3300010049 Bacteria 1009
16 Ga0123356_11831493 3300010049 Bacteria 755
17 Ga0123356_12006665 3300010049 Bacteria 721
18 Ga0123353_10040622 3300010167 Bacteria 7341
19 Ga0123353_11156130 3300010167 Bacteria 1021
20 Ga0123353_12737039 3300010167 Unclassified 580
21 Ga0123354_10045144 3300010882 Archaea 6749
22 Ga0466711_112436 3300042615 Bacteria 7848
23 Ga0466692_088854 3300042591 Bacteria 6534
24 Ga0466706_047291 3300042599 Bacteria 2677
25 Ga0466714_032903 3300042603 Bacteria 1224
26 Ga0466714_150209 3300042603 Bacteria 1018
27 Ga0466722_155108 3300042609 Bacteria 14612
28 Ga0466731_045725 3300042622 Bacteria 2030
29 Ga0466703_199214 3300042636 Bacteria 4441
30 Ga0466708_388971 3300042652 Bacteria 5217
31 2227514922 2225789004 Bacteria 3470
32 IMNBL1DRAFT_c0040820 3300000062 Bacteria 1565
33 Ga0123355_10427035 3300009826 Bacteria 1689
34 Ga0123356_10000288 3300010049 Bacteria 57856
35 Ga0123356_10161258 3300010049 Bacteria 2240
36 Ga0123353_10003135 3300010167 Bacteria 20754
37 Ga0123353_10027551 3300010167 Bacteria 8711
38 Ga0123353_10144595 3300010167 Bacteria 3804
39 Ga0530661_000037 3300056564 Bacteria 153146
40 Ga0415639_011193 3300038395 Unclassified 2259
41 Ga0415639_086175 3300038395 Bacteria 2379
42 Ga0415639_134863 3300038395 Bacteria 2842
43 Ga0466693_068240 3300042592 Bacteria 1249
44 Ga0466707_229571 3300042601 Bacteria 15818
45 Ga0466714_157288 3300042603 Bacteria 1607
46 Ga0466717_118511 3300042604 Bacteria 1288
47 Ga0466722_009822 3300042609 Bacteria 2321
48 Ga0466705_064011 3300042612 Bacteria 1232
49 IMNBL1DRAFT_c0033134 3300000062 Bacteria 1853
50 Ga0123357_10575353 3300009784 Bacteria 881
51 Ga0123357_10738716 3300009784 Bacteria 689
52 Ga0123355_10584638 3300009826 Bacteria 1333
53 Ga0123355_11465159 3300009826 Unclassified 669
54 Ga0123356_10345395 3300010049 Bacteria 1610
55 Ga0123356_10794474 3300010049 Bacteria 1117
56 Ga0123356_11611583 3300010049 Bacteria 803
57 Ga0123353_10046518 3300010167 Bacteria 6896
58 Ga0123353_10385353 3300010167 Bacteria 2094
59 Ga0123353_10475103 3300010167 Bacteria 1831
60 Ga0123353_10829673 3300010167 Bacteria 1271
61 Ga0123353_10838833 3300010167 Bacteria 1262
62 Ga0123353_11130133 3300010167 Bacteria 1036
63 Ga0415639_012343 3300038395 Bacteria 15773
64 Ga0415639_118352 3300038395 Bacteria 1077
65 Ga0466696_320534 3300042596 Bacteria 5197
66 Ga0466700_338740 3300042600 Bacteria 1020
67 Ga0466707_205337 3300042601 Bacteria 2314
68 Ga0466707_312049 3300042601 Bacteria 10729
69 Ga0466714_128246 3300042603 Bacteria 1014
70 Ga0466705_256104 3300042612 Bacteria 1852
71 IMNBL1DRAFT_c0026529 3300000062 Unclassified 2197
72 Ga0123355_10401539 3300009826 Bacteria 1767
73 Ga0123355_10458568 3300009826 Bacteria 1601
74 Ga0123355_11320207 3300009826 Bacteria 722
75 Ga0123356_10017486 3300010049 Bacteria 6821
76 Ga0466715_003492 3300042616 Bacteria 1337
77 Ga0466718_145959 3300042617 Bacteria 5702
78 Ga0415639_029012 3300038395 Bacteria 11336
79 Ga0415639_150469 3300038395 Bacteria 1947
80 Ga0415639_211929 3300038395 Bacteria 1155
81 Ga0466707_256715 3300042601 Bacteria 5971
82 Ga0466714_035031 3300042603 Bacteria 1120
83 Ga0466714_158767 3300042603 Bacteria 1266
84 Ga0466721_068685 3300042608 Bacteria 1829
85 Ga0466722_129078 3300042609 Bacteria 1348
86 Ga0466703_330020 3300042636 Bacteria 2069
87 Ga0123356_10060391 3300010049 Bacteria 3538
88 Ga0123356_10919179 3300010049 Bacteria 1046
89 Ga0123356_11185103 3300010049 Bacteria 930
90 Ga0123356_11624192 3300010049 Unclassified 800
91 Ga0123353_10675590 3300010167 Bacteria 1456
92 Ga0466715_249615 3300042616 Bacteria 2369
93 Ga0415639_160575 3300038395 Unclassified 1393
94 Ga0466692_159212 3300042591 Bacteria 1250
95 Ga0466696_421577 3300042596 Bacteria 6390
96 Ga0466706_185875 3300042599 Bacteria 2838
97 Ga0466716_328004 3300042605 Bacteria 4734
98 Ga0466731_088597 3300042622 Unclassified 1264
99 Ga0466703_152672 3300042636 Bacteria 4425
100 2227536323 2225789004 Bacteria 3064
101 Ga0072940_1025186 3300005200 Bacteria 6424
102 Ga0123355_10209805 3300009826 Bacteria 2825
103 Ga0123355_10594595 3300009826 Unclassified 1316
104 Ga0123355_10692806 3300009826 Bacteria 1173
105 Ga0123356_10088375 3300010049 Bacteria 2946
106 Ga0123356_10376926 3300010049 Bacteria 1550
107 Ga0123356_10423926 3300010049 Bacteria 1473
108 Ga0123353_10003659 3300010167 Bacteria 19498
109 Ga0123353_10557043 3300010167 Bacteria 1651
110 Ga0123353_10567662 3300010167 Bacteria 1632
111 Ga0466718_027003 3300042617 Bacteria 1736
112 Ga0466723_229156 3300042618 Bacteria 2001
113 Ga0415639_004623 3300038395 Bacteria 5980
114 Ga0415639_009219 3300038395 Bacteria 1889
115 Ga0415639_014364 3300038395 Bacteria 3095
116 Ga0466700_244435 3300042600 Bacteria 1053
117 Ga0466717_294945 3300042604 Bacteria 1096
118 Ga0466731_108415 3300042622 Bacteria 1527
119 Ga0466704_018276 3300042643 Bacteria 2288
120 Ga0466727_135211 3300042655 Bacteria 4316
121 2227329408 2225789004 Bacteria 1175
122 Ga0072941_1741145 3300005201 Bacteria 1212
123 Ga0123357_10522553 3300009784 Bacteria 968
124 Ga0123356_11447588 3300010049 Bacteria 846
125 Ga0123353_10415526 3300010167 Bacteria 1995
126 Ga0123353_11911327 3300010167 Bacteria 732
127 Ga0123353_13243207 3300010167 Bacteria 520
128 Ga0415639_160576 3300038395 Bacteria 1931
129 Ga0466707_033398 3300042601 Bacteria 8356
130 Ga0466707_089398 3300042601 Bacteria 1909
131 Ga0466707_362890 3300042601 Bacteria 1676
132 Ga0466705_157387 3300042612 Bacteria 3639
133 Ga0466731_234435 3300042622 Bacteria 1177

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042622 Ga0466731_088597 Ga0466731_088597_364_717 117
2 3300042605 Ga0466716_328004 Ga0466716_328004_561_938 125
3 3300042612 Ga0466705_064011 Ga0466705_064011_407_841 128
4 3300042591 Ga0466692_088854 Ga0466692_088854_2654_3046 130
5 3300042591 Ga0466692_159212 Ga0466692_159212_351_743 130
6 3300042609 Ga0466722_155108 Ga0466722_155108_293_685 130
7 3300042612 Ga0466705_157387 Ga0466705_157387_2515_2907 130
8 3300042652 Ga0466708_388971 Ga0466708_388971_3172_3564 130
9 3300010167 Ga0123353_12737039 Ga0123353_127370391 132
10 3300009826 Ga0123355_10209805 Ga0123355_102098054 134
11 3300042603 Ga0466714_158767 Ga0466714_158767_446_850 134
12 3300042603 Ga0466714_158767 Ga0466714_158767_446_850 134
13 3300042601 Ga0466707_256715 Ga0466707_256715_1488_1916 135
14 3300042601 Ga0466707_256715 Ga0466707_256715_1488_1916 135
15 3300042601 Ga0466707_362890 Ga0466707_362890_306_734 135
16 3300042615 Ga0466711_219529 Ga0466711_219529_6401_6808 135
17 3300042636 Ga0466703_275711 Ga0466703_275711_1212_1640 135
18 3300010167 Ga0123353_10027551 Ga0123353_1002755111 136
19 3300010167 Ga0123353_10046518 Ga0123353_100465184 136
20 3300038395 Ga0415639_101313 Ga0415639_101313_843_1253 136
21 3300038395 Ga0415639_118352 Ga0415639_118352_214_624 136
22 3300042615 Ga0466711_112436 Ga0466711_112436_413_823 136
23 3300042617 Ga0466718_027003 Ga0466718_027003_332_742 136
24 2225789004 2227329408 2227776950 137
25 3300005201 Ga0072941_1741145 Ga0072941_17411451 137
26 3300009784 Ga0123357_10522553 Ga0123357_105225532 137
27 3300009784 Ga0123357_10738716 Ga0123357_107387161 137
28 3300009826 Ga0123355_10208317 Ga0123355_102083174 137
29 3300009826 Ga0123355_10584638 Ga0123355_105846381 137
30 3300009826 Ga0123355_10594595 Ga0123355_105945953 137
31 3300010049 Ga0123356_10423926 Ga0123356_104239263 137
32 3300010167 Ga0123353_10415526 Ga0123353_104155263 137
33 3300042601 Ga0466707_089398 Ga0466707_089398_1288_1701 137
34 3300042601 Ga0466707_205337 Ga0466707_205337_23_436 137
35 3300010049 Ga0123356_11611583 Ga0123356_116115832 138
36 3300010049 Ga0123356_11611583 Ga0123356_116115832 138
37 3300010167 Ga0123353_10144595 Ga0123353_101445953 138
38 3300010167 Ga0123353_10567662 Ga0123353_105676623 138
39 3300038395 Ga0415639_011193 Ga0415639_011193_506_922 138
40 3300038395 Ga0415639_134863 Ga0415639_134863_909_1325 138
41 3300042599 Ga0466706_220490 Ga0466706_220490_47446_47862 138
42 3300042603 Ga0466714_035031 Ga0466714_035031_251_667 138
43 3300042603 Ga0466714_035031 Ga0466714_035031_251_667 138
44 3300042603 Ga0466714_150209 Ga0466714_150209_324_740 138
45 3300042603 Ga0466714_150209 Ga0466714_150209_324_740 138
46 3300042603 Ga0466714_157288 Ga0466714_157288_480_896 138
47 3300042655 Ga0466727_135211 Ga0466727_135211_81_497 138
48 3300042655 Ga0466727_135211 Ga0466727_135211_81_497 138
49 3300010167 Ga0123353_13243207 Ga0123353_132432072 139
50 3300010167 Ga0123353_13243207 Ga0123353_132432072 139
51 3300042612 Ga0466705_256104 Ga0466705_256104_1132_1566 139
52 3300042636 Ga0466703_152672 Ga0466703_152672_1207_1626 139
53 3300042596 Ga0466696_320534 Ga0466696_320534_1474_1896 140
54 3300042601 Ga0466707_312049 Ga0466707_312049_3620_4042 140
55 3300042609 Ga0466722_009822 Ga0466722_009822_721_1143 140
56 3300010049 Ga0123356_10312002 Ga0123356_103120023 141
57 2225789004 2227536323 2228054296 142
58 iso_pr_bacteria 2820389254 2820389404 142
59 3300010049 Ga0123356_10794474 Ga0123356_107944742 143
60 3300010049 Ga0123356_10794474 Ga0123356_107944742 143
61 3300010049 Ga0123356_11831493 Ga0123356_118314932 143
62 3300010167 Ga0123353_10003659 Ga0123353_1000365923 143
63 3300010167 Ga0123353_10829673 Ga0123353_108296733 143
64 3300038395 Ga0415639_004623 Ga0415639_004623_566_997 143
65 3300038395 Ga0415639_014364 Ga0415639_014364_510_941 143
66 3300038395 Ga0415639_029012 Ga0415639_029012_1440_1871 143
67 3300038395 Ga0415639_086175 Ga0415639_086175_1583_2014 143
68 3300042601 Ga0466707_229571 Ga0466707_229571_13457_13888 143
69 3300042603 Ga0466714_032903 Ga0466714_032903_261_692 143
70 3300042603 Ga0466714_032903 Ga0466714_032903_261_692 143
71 3300042618 Ga0466723_229156 Ga0466723_229156_519_950 143
72 3300042622 Ga0466731_045725 Ga0466731_045725_872_1303 143
73 3300042622 Ga0466731_108415 Ga0466731_108415_450_881 143
74 3300042622 Ga0466731_108415 Ga0466731_108415_450_881 143
75 3300042622 Ga0466731_234435 Ga0466731_234435_601_1032 143
76 3300042636 Ga0466703_199214 Ga0466703_199214_3135_3566 143
77 3300042636 Ga0466703_330020 Ga0466703_330020_763_1194 143
78 3300056564 Ga0530661_000037 Ga0530661_000037_91116_91547 143
79 3300000062 IMNBL1DRAFT_c0033134 IMNBL1DRAFT_00331343 144
80 3300005200 Ga0072940_1025186 Ga0072940_10251869 144
81 3300009826 Ga0123355_10108289 Ga0123355_101082893 144
82 3300009826 Ga0123355_10427035 Ga0123355_104270353 144
83 3300009826 Ga0123355_10458568 Ga0123355_104585682 144
84 3300009826 Ga0123355_10619075 Ga0123355_106190753 144
85 3300009826 Ga0123355_10619075 Ga0123355_106190753 144
86 3300009826 Ga0123355_10692806 Ga0123355_106928062 144
87 3300009826 Ga0123355_11465159 Ga0123355_114651592 144
88 3300010049 Ga0123356_10088375 Ga0123356_100883756 144
89 3300010049 Ga0123356_10345395 Ga0123356_103453952 144
90 3300010049 Ga0123356_10376926 Ga0123356_103769262 144
91 3300010049 Ga0123356_10919179 Ga0123356_109191793 144
92 3300010049 Ga0123356_12006665 Ga0123356_120066652 144
93 3300010049 Ga0123356_12006665 Ga0123356_120066652 144
94 3300010049 Ga0123356_12834009 Ga0123356_128340092 144
95 3300010167 Ga0123353_10475103 Ga0123353_104751033 144
96 3300010167 Ga0123353_10675590 Ga0123353_106755904 144
97 3300010167 Ga0123353_10799625 Ga0123353_107996252 144
98 3300010167 Ga0123353_11156130 Ga0123353_111561303 144
99 3300038395 Ga0415639_211929 Ga0415639_211929_75_509 144
100 3300038395 Ga0415639_211929 Ga0415639_211929_75_509 144
101 3300042592 Ga0466693_068240 Ga0466693_068240_801_1235 144
102 3300042596 Ga0466696_421577 Ga0466696_421577_988_1422 144
103 3300042599 Ga0466706_047291 Ga0466706_047291_1683_2117 144
104 3300042599 Ga0466706_185875 Ga0466706_185875_1958_2392 144
105 3300042604 Ga0466717_118511 Ga0466717_118511_648_1082 144
106 3300042604 Ga0466717_118511 Ga0466717_118511_648_1082 144
107 3300042609 Ga0466722_129078 Ga0466722_129078_588_1022 144
108 3300042616 Ga0466715_003492 Ga0466715_003492_840_1274 144
109 3300042616 Ga0466715_249615 Ga0466715_249615_242_676 144
110 3300042643 Ga0466704_018276 Ga0466704_018276_1030_1464 144
111 3300009826 Ga0123355_10012767 Ga0123355_100127674 145
112 3300010049 Ga0123356_10000288 Ga0123356_1000028817 145
113 3300010049 Ga0123356_11447588 Ga0123356_114475882 145
114 3300010167 Ga0123353_11911327 Ga0123353_119113272 145
115 3300010167 Ga0123353_11911327 Ga0123353_119113272 145
116 3300038395 Ga0415639_009219 Ga0415639_009219_741_1178 145
117 3300038395 Ga0415639_009219 Ga0415639_009219_741_1178 145
118 3300038395 Ga0415639_012343 Ga0415639_012343_7482_7919 145
119 3300038395 Ga0415639_160575 Ga0415639_160575_13_450 145
120 3300038395 Ga0415639_160576 Ga0415639_160576_13_450 145
121 3300042601 Ga0466707_033398 Ga0466707_033398_7292_7729 145
122 3300042602 Ga0466713_079928 Ga0466713_079928_737_1174 145
123 3300010049 Ga0123356_10017486 Ga0123356_100174868 146
124 3300010049 Ga0123356_10993869 Ga0123356_109938692 146
125 3300010167 Ga0123353_10040622 Ga0123353_100406221 146
126 3300009784 Ga0123357_10575353 Ga0123357_105753532 147
127 3300009826 Ga0123355_11320207 Ga0123355_113202072 147
128 3300010167 Ga0123353_10838833 Ga0123353_108388331 147
129 3300010167 Ga0123353_10838833 Ga0123353_108388331 147
130 3300010882 Ga0123354_10045144 Ga0123354_100451446 147
131 3300010167 Ga0123353_11244800 Ga0123353_112448002 148
132 3300042617 Ga0466718_145959 Ga0466718_145959_45_491 148
133 3300009826 Ga0123355_10401539 Ga0123355_104015394 149
134 iso_pr_bacteria 2820131053 2820132282 149
135 3300010167 Ga0123353_10003135 Ga0123353_1000313512 150
136 3300010167 Ga0123353_11130133 Ga0123353_111301332 150
137 3300010167 Ga0123353_11130133 Ga0123353_111301332 150
138 2225789004 2227514922 2228012765 154
139 3300038395 Ga0415639_150469 Ga0415639_150469_372_836 154
140 3300038395 Ga0415639_150469 Ga0415639_150469_372_836 154
141 3300042604 Ga0466717_294945 Ga0466717_294945_508_972 154
142 3300042608 Ga0466721_068685 Ga0466721_068685_860_1324 154
143 3300042608 Ga0466721_068685 Ga0466721_068685_860_1324 154
144 3300000062 IMNBL1DRAFT_c0026529 IMNBL1DRAFT_00265296 155
145 3300000062 IMNBL1DRAFT_c0040820 IMNBL1DRAFT_00408204 155
146 3300010049 Ga0123356_10060391 Ga0123356_100603912 155
147 3300010049 Ga0123356_10161258 Ga0123356_101612582 155
148 3300010049 Ga0123356_11624192 Ga0123356_116241922 155
149 3300042600 Ga0466700_244435 Ga0466700_244435_421_894 157
150 3300010167 Ga0123353_10385353 Ga0123353_103853534 158
151 3300010167 Ga0123353_10557043 Ga0123353_105570431 158
152 3300042603 Ga0466714_128246 Ga0466714_128246_213_692 159
153 3300010049 Ga0123356_11185103 Ga0123356_111851032 160
154 3300042600 Ga0466700_338740 Ga0466700_338740_48_542 164
155 3300042600 Ga0466700_338740 Ga0466700_338740_48_542 164
156 3300038395 Ga0415639_111674 Ga0415639_111674_7007_7510 167

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04883 HK97-gp10_like Bacteriophage HK97-gp10, putative tail-component 16 113 0.78

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
8gv0-assembly4.cif.gz_G Crystal structure of anti-FIXa IgG fab without FAST-Ig mutations 0.626 73 91
1eyg-assembly1.cif.gz_B Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS 0.617 74 93
5djz-assembly1.cif.gz_B Fc Heterodimer Design 7.8 D399M/Y407A + T366V/K409V 0.616 73 93
5vme-assembly1.cif.gz_B Crystal structure of human IgG1 Fc K248E, T437R mutant 0.613 73 93
5czv-assembly1.cif.gz_H Crystal structure of Notch3 NRR in complex with 20350 Fab 0.606 73 99
IDDescriptionScoreStartEndSuperfamily
af_Q2G2S5_1_133_3.30.70.590 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Poly(A) polymerase predicted RNA binding domain 0.7564 12 143 3.30.70.590
5djzB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.616 73 93 2.60.40.10
6d4nB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5612 61 93 2.60.40.10
5wdfH02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5494 72 98 2.60.40.10
af_M9MMF9_1287_1397_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5457 63 93 2.60.40.10
IDDescriptionScoreStartEndGO Terms
AF-A0A498CVT4-F1-model_v4 HK97 gp10 family phage protein 0.904 1 151
AF-A0A1F2PDB6-F1-model_v4 HK97 gp10 family phage protein 0.8918 21 151

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.