Protein Family IF04323

Metagenome Isolate
115 Members
38 Samples
110 Scaffolds
310.98 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_109370|Ga0415639_109370_1619_2635
Length
338 aa
Sequence
MSIRKIAAKMAENWPAKVLSIGLAIIIFVFHRMSTQEERFFSVPLSIDRSGPLVPAASYPRMIRVNLRGEPASVFSIMENDIEVYIDMNRLEQPGVYTVPVQWRKRNTIQGGEPVQITVDPMEITLSLDHRITRTVPVTADLRGQIDTGHTMTWHSLNPAQVVIEGPAALISGVPEIFTEVINLAGRRNDFSQVAAILNPDPLVIILGSGTTEFRGSVAQIIPVRNIANVPIAITGLMEGLAGELEIAAASLRLEGGSQAALDAFVPGADFLQVDASGIEQPGTYILRVLAASADNVSITVDLEEVILYISLSDIADPRYPGDLTGLDDIIYDEDEAL

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 32.4%
Unclassified 16.2%
Termopsidae 8.1%
Rhinotermitidae 5.4%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
13 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_307357 3300042643 Bacteria 6010
2 Ga0466727_070464 3300042655 Bacteria 4051
3 Ga0466707_233608 3300042601 Bacteria 1100
4 Ga0466720_057406 3300042607 Bacteria 28295
5 Ga0466715_243549 3300042616 Bacteria 13882
6 Ga0466715_548575 3300042616 Bacteria 6310
7 Ga0466694_056566 3300042594 Bacteria 4033
8 Ga0466703_058685 3300042636 Bacteria 36786
9 Ga0466704_166632 3300042643 Bacteria 9299
10 Ga0466708_184464 3300042652 Bacteria 3881
11 Ga0466708_334123 3300042652 Bacteria 55617
12 Ga0466727_017069 3300042655 Bacteria 2248
13 Ga0466727_253152 3300042655 Bacteria 2475
14 Ga0466720_111891 3300042607 Bacteria 23574
15 Ga0466711_081013 3300042615 Bacteria 10213
16 Ga0466715_549137 3300042616 Bacteria 3704
17 Ga0466723_033385 3300042618 Bacteria 15758
18 Ga0466723_052167 3300042618 Bacteria 6533
19 Ga0415639_232556 3300038395 Bacteria 1673
20 Ga0466696_349334 3300042596 Bacteria 1387
21 JGI24698J34947_10000878 3300002449 Bacteria 15193
22 JGI24698J34947_10001064 3300002449 Bacteria 14129
23 JGI24698J34947_10017876 3300002449 Bacteria 3839
24 Ga0072941_1059492 3300005201 Bacteria 18068
25 Ga0466733_104487 3300042659 Bacteria 1383
26 Ga0466703_019965 3300042636 Bacteria 1964
27 Ga0466703_301914 3300042636 Bacteria 1249
28 Ga0466703_393169 3300042636 Bacteria 3785
29 Ga0466704_347511 3300042643 Bacteria 15892
30 Ga0466716_345161 3300042605 Bacteria 3465
31 Ga0466712_076648 3300042614 Bacteria 31023
32 Ga0466712_172819 3300042614 Bacteria 12746
33 Ga0466711_011465 3300042615 Bacteria 7895
34 Ga0466718_033853 3300042617 Bacteria 13524
35 Ga0466723_133933 3300042618 Bacteria 2735
36 Ga0466726_243314 3300042619 Bacteria 1112
37 Ga0466726_291647 3300042619 Bacteria 1235
38 Ga0466691_049619 3300042593 Bacteria 15579
39 Ga0466694_059553 3300042594 Unclassified 2704
40 Ga0466694_400844 3300042594 Bacteria 2343
41 JGI24698J34947_10001891 3300002449 Bacteria 11161
42 Ga0466705_356905 3300042612 Bacteria 29178
43 Ga0466704_046384 3300042643 Bacteria 22946
44 Ga0466708_080579 3300042652 Bacteria 4877
45 Ga0466716_159325 3300042605 Bacteria 11511
46 Ga0466719_104809 3300042606 Bacteria 3464
47 Ga0466719_389225 3300042606 Bacteria 11545
48 Ga0466712_085801 3300042614 Bacteria 23112
49 Ga0466711_306255 3300042615 Bacteria 1926
50 Ga0466715_000572 3300042616 Bacteria 21083
51 Ga0415639_257311 3300038395 Bacteria 1364
52 Ga0466703_254861 3300042636 Bacteria 6146
53 Ga0466727_206613 3300042655 Bacteria 1562
54 Ga0466727_259375 3300042655 Bacteria 4866
55 Ga0466705_407181 3300042612 Bacteria 4904
56 Ga0466715_623529 3300042616 Bacteria 9125
57 Ga0466726_049611 3300042619 Bacteria 21342
58 Ga0466690_307247 3300042590 Bacteria 1611
59 Ga0466691_187278 3300042593 Bacteria 9907
60 Ga0123353_10243458 3300010167 Bacteria 2792
61 Ga0123353_10430498 3300010167 Bacteria 1951
62 Ga0466705_146183 3300042612 Bacteria 7473
63 Ga0466703_020316 3300042636 Bacteria 1175
64 Ga0466719_252781 3300042606 Bacteria 5713
65 Ga0466719_517032 3300042606 Bacteria 2211
66 Ga0466715_137352 3300042616 Bacteria 2568
67 Ga0466715_239229 3300042616 Bacteria 14401
68 Ga0466715_456991 3300042616 Bacteria 2685
69 Ga0466718_084149 3300042617 Bacteria 9125
70 Ga0466723_206226 3300042618 Bacteria 4965
71 Ga0466726_213065 3300042619 Bacteria 3258
72 Ga0466726_457625 3300042619 Bacteria 3773
73 Ga0415639_109370 3300038395 Bacteria 2692
74 Ga0466694_250394 3300042594 Bacteria 6992
75 Ga0466695_318570 3300042595 Bacteria 4252
76 Ga0123353_10025059 3300010167 Bacteria 9077
77 Ga0123353_10366470 3300010167 Bacteria 2162
78 Ga0123353_10615179 3300010167 Bacteria 1548
79 JGI24698J34947_10011556 3300002449 Bacteria 4846
80 Ga0466703_069449 3300042636 Bacteria 19224
81 Ga0466709_355067 3300042648 Bacteria 1272
82 Ga0466709_384223 3300042648 Bacteria 15086
83 Ga0466727_343802 3300042655 Bacteria 1509
84 Ga0466719_403668 3300042606 Bacteria 8615
85 Ga0466720_031040 3300042607 Bacteria 19260
86 Ga0466705_437384 3300042612 Bacteria 18300
87 Ga0466712_012501 3300042614 Bacteria 1937
88 Ga0466726_152828 3300042619 Bacteria 3292
89 Ga0466726_246112 3300042619 Bacteria 1842
90 Ga0415639_094728 3300038395 Bacteria 3948
91 Ga0415639_113158 3300038395 Bacteria 6369
92 Ga0123353_10271024 3300010167 Bacteria 2615
93 Ga0123353_10560919 3300010167 Bacteria 1644
94 JGI24698J34947_10003882 3300002449 Bacteria 8130
95 Ga0072940_1022560 3300005200 Bacteria 8087
96 Ga0466705_136352 3300042612 Bacteria 10984
97 Ga0466729_209216 3300042621 Bacteria 1865
98 Ga0466735_101552 3300042624 Bacteria 3340
99 Ga0466727_175526 3300042655 Bacteria 7298
100 Ga0466700_418203 3300042600 Bacteria 1621
101 Ga0466707_401173 3300042601 Bacteria 2058
102 Ga0466720_035328 3300042607 Bacteria 9131
103 Ga0466722_248094 3300042609 Bacteria 4921
104 Ga0466712_069198 3300042614 Bacteria 2747
105 Ga0466715_250478 3300042616 Bacteria 13481
106 Ga0466723_356718 3300042618 Bacteria 8341
107 Ga0466728_175439 3300042620 Bacteria 13012
108 Ga0466728_320606 3300042620 Bacteria 11540
109 Ga0123353_10248130 3300010167 Bacteria 2760
110 AustNasuHG_c1011781 3300000089 Bacteria 3028

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_291647 Ga0466726_291647_43_837 254
2 3300042636 Ga0466703_301914 Ga0466703_301914_35_808 257
3 3300010167 Ga0123353_10243458 Ga0123353_102434584 261
4 3300005200 Ga0072940_1022560 Ga0072940_10225608 263
5 3300038395 Ga0415639_232556 Ga0415639_232556_330_1130 266
6 3300042636 Ga0466703_020316 Ga0466703_020316_50_913 275
7 3300042614 Ga0466712_085801 Ga0466712_085801_19811_20677 288
8 3300042609 Ga0466722_248094 Ga0466722_248094_891_1778 295
9 3300042636 Ga0466703_393169 Ga0466703_393169_2797_3759 295
10 3300042619 Ga0466726_246112 Ga0466726_246112_689_1633 297
11 3300042612 Ga0466705_407181 Ga0466705_407181_3265_4224 298
12 3300002449 JGI24698J34947_10000878 JGI24698J34947_100008784 300
13 3300002449 JGI24698J34947_10017876 JGI24698J34947_100178766 300
14 3300042614 Ga0466712_172819 Ga0466712_172819_533_1507 300
15 3300002449 JGI24698J34947_10001891 JGI24698J34947_100018914 301
16 3300042619 Ga0466726_213065 Ga0466726_213065_1524_2516 304
17 3300042606 Ga0466719_517032 Ga0466719_517032_214_1164 305
18 3300042655 Ga0466727_175526 Ga0466727_175526_1054_2004 305
19 3300010167 Ga0123353_10248130 Ga0123353_102481302 306
20 3300042619 Ga0466726_152828 Ga0466726_152828_1992_2945 306
21 3300002449 JGI24698J34947_10003882 JGI24698J34947_100038827 307
22 3300002449 JGI24698J34947_10011556 JGI24698J34947_100115564 307
23 3300042605 Ga0466716_159325 Ga0466716_159325_2947_3906 307
24 3300042636 Ga0466703_019965 Ga0466703_019965_743_1702 307
25 3300042643 Ga0466704_046384 Ga0466704_046384_15872_16831 307
26 3300042606 Ga0466719_403668 Ga0466719_403668_5135_6091 308
27 3300042636 Ga0466703_254861 Ga0466703_254861_3648_4616 308
28 3300042643 Ga0466704_347511 Ga0466704_347511_11344_12303 308
29 3300042648 Ga0466709_355067 Ga0466709_355067_137_1102 308
30 3300042612 Ga0466705_146183 Ga0466705_146183_471_1436 309
31 3300042616 Ga0466715_623529 Ga0466715_623529_1706_2668 309
32 3300042618 Ga0466723_356718 Ga0466723_356718_3767_4726 309
33 3300042619 Ga0466726_049611 Ga0466726_049611_6817_7767 309
34 3300042636 Ga0466703_058685 Ga0466703_058685_6484_7446 309
35 3300042636 Ga0466703_069449 Ga0466703_069449_5638_6594 309
36 3300042648 Ga0466709_384223 Ga0466709_384223_2370_3341 309
37 3300042600 Ga0466700_418203 Ga0466700_418203_56_1012 310
38 3300042606 Ga0466719_389225 Ga0466719_389225_5883_6848 310
39 3300042607 Ga0466720_057406 Ga0466720_057406_13208_14161 310
40 3300042607 Ga0466720_111891 Ga0466720_111891_3122_4075 310
41 3300042617 Ga0466718_084149 Ga0466718_084149_6957_7910 310
42 3300042655 Ga0466727_017069 Ga0466727_017069_1212_2231 310
43 3300042655 Ga0466727_259375 Ga0466727_259375_742_1707 310
44 3300042655 Ga0466727_343802 Ga0466727_343802_44_1015 310
45 3300000089 AustNasuHG_c1011781 AustNasuHG_10117814 311
46 3300042596 Ga0466696_349334 Ga0466696_349334_372_1340 311
47 3300042612 Ga0466705_136352 Ga0466705_136352_5507_6472 311
48 3300042614 Ga0466712_076648 Ga0466712_076648_3852_4829 311
49 3300042616 Ga0466715_250478 Ga0466715_250478_2371_3336 311
50 3300042618 Ga0466723_206226 Ga0466723_206226_1419_2384 311
51 3300042619 Ga0466726_457625 Ga0466726_457625_2501_3478 311
52 3300042643 Ga0466704_307357 Ga0466704_307357_2855_3820 311
53 3300042652 Ga0466708_080579 Ga0466708_080579_1483_2451 311
54 3300010167 Ga0123353_10271024 Ga0123353_102710243 312
55 3300042619 Ga0466726_243314 Ga0466726_243314_113_1084 312
56 3300042594 Ga0466694_059553 Ga0466694_059553_826_1767 313
57 3300042607 Ga0466720_031040 Ga0466720_031040_7441_8403 313
58 3300042612 Ga0466705_437384 Ga0466705_437384_2349_3314 313
59 3300042616 Ga0466715_548575 Ga0466715_548575_4355_5320 313
60 3300042616 Ga0466715_549137 Ga0466715_549137_2366_3331 313
61 3300042620 Ga0466728_320606 Ga0466728_320606_8270_9241 313
62 3300042655 Ga0466727_070464 Ga0466727_070464_2360_3328 313
63 3300010167 Ga0123353_10430498 Ga0123353_104304983 314
64 3300042593 Ga0466691_187278 Ga0466691_187278_4850_5818 314
65 3300042615 Ga0466711_011465 Ga0466711_011465_3471_4448 314
66 3300042616 Ga0466715_000572 Ga0466715_000572_5903_6883 314
67 3300042616 Ga0466715_239229 Ga0466715_239229_13078_14049 314
68 3300042606 Ga0466719_104809 Ga0466719_104809_149_1120 315
69 3300042606 Ga0466719_252781 Ga0466719_252781_3798_4769 315
70 3300042612 Ga0466705_356905 Ga0466705_356905_6267_7238 315
71 3300042652 Ga0466708_184464 Ga0466708_184464_1954_2925 315
72 iso_pr_bacteria 2781125652 2781311912 315
73 3300038395 Ga0415639_094728 Ga0415639_094728_509_1459 316
74 3300038395 Ga0415639_257311 Ga0415639_257311_159_1109 316
75 3300042594 Ga0466694_400844 Ga0466694_400844_275_1225 316
76 iso_pr_bacteria 2781125681 2781407368 316
77 3300005201 Ga0072941_1059492 Ga0072941_105949218 317
78 3300042620 Ga0466728_175439 Ga0466728_175439_3682_4665 317
79 3300042659 Ga0466733_104487 Ga0466733_104487_70_1023 317
80 3300042594 Ga0466694_056566 Ga0466694_056566_2075_3031 318
81 3300042594 Ga0466694_250394 Ga0466694_250394_4325_5281 318
82 3300042614 Ga0466712_012501 Ga0466712_012501_89_1045 318
83 3300042617 Ga0466718_033853 Ga0466718_033853_4060_5016 318
84 3300042655 Ga0466727_253152 Ga0466727_253152_572_1543 318
85 3300010167 Ga0123353_10560919 Ga0123353_105609192 319
86 3300010167 Ga0123353_10615179 Ga0123353_106151791 319
87 3300042595 Ga0466695_318570 Ga0466695_318570_2746_3705 319
88 3300010167 Ga0123353_10366470 Ga0123353_103664702 320
89 3300042614 Ga0466712_069198 Ga0466712_069198_1274_2236 320
90 3300042615 Ga0466711_306255 Ga0466711_306255_373_1335 320
91 3300042616 Ga0466715_243549 Ga0466715_243549_8086_9048 320
92 3300042652 Ga0466708_334123 Ga0466708_334123_48106_49068 320
93 3300002449 JGI24698J34947_10001064 JGI24698J34947_1000106413 321
94 3300042590 Ga0466690_307247 Ga0466690_307247_450_1415 321
95 3300042607 Ga0466720_035328 Ga0466720_035328_5278_6264 321
96 3300042616 Ga0466715_137352 Ga0466715_137352_1149_2114 321
97 3300042616 Ga0466715_456991 Ga0466715_456991_1167_2132 321
98 3300042618 Ga0466723_133933 Ga0466723_133933_1619_2584 321
99 3300042624 Ga0466735_101552 Ga0466735_101552_870_1835 321
100 iso_pr_bacteria 2781125629 2781264981 321
101 iso_pr_bacteria 2781125630 2781267049 321
102 3300010167 Ga0123353_10025059 Ga0123353_100250594 322
103 3300042621 Ga0466729_209216 Ga0466729_209216_168_1136 322
104 3300042593 Ga0466691_049619 Ga0466691_049619_3150_4121 323
105 3300042655 Ga0466727_206613 Ga0466727_206613_234_1205 323
106 3300038395 Ga0415639_113158 Ga0415639_113158_3352_4326 324
107 3300042615 Ga0466711_081013 Ga0466711_081013_7097_8071 324
108 3300042618 Ga0466723_052167 Ga0466723_052167_3857_4834 325
109 3300042605 Ga0466716_345161 Ga0466716_345161_2425_3405 326
110 3300042643 Ga0466704_166632 Ga0466704_166632_1190_2170 326
111 3300042601 Ga0466707_233608 Ga0466707_233608_101_1084 327
112 iso_pr_bacteria 2781125632 2781271479 327
113 3300042601 Ga0466707_401173 Ga0466707_401173_869_1888 329
114 3300042618 Ga0466723_033385 Ga0466723_033385_4008_5036 331
115 3300038395 Ga0415639_109370 Ga0415639_109370_1619_2635 338

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07949 YbbR YbbR-like protein 136 206 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.64 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.