Protein Family IF04299

Metagenome Isolate
125 Members
71 Samples
101 Scaffolds
513.63 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_037948|Ga0415639_037948_3117_4934
Length
605 aa
Sequence
LAEITRNPLTTGVTLSGGEPMDQADALIPVAKSLKERGYDLWIYTGYLWEDLDGAKKTLSMLADVIVDGPYDASLRSLTLPWRGSSNQRLIDVXKKRALFSVSDKTGVCEFARRCSALGYEIISTGGTQEALEESGIAVTNVSAVTGFPECLGGRLKTLHPAIHGGILAMRDNRDHMAQLDVLNIGVIDIVVINLYPFKQTIQIPGVHLDEAIENIDVGGPALIRSAAKNWPDVVVAVDPYDYDDILDQLENGGVSRERRFELACKVFEHTAHYDAVIADYLRRQAGISFPETFTLTYEKAQDLRYGENPHQAAAFYRGFGRLQGTLAKAEHLHGKELSFCNINDSAAAIAVVKEFDQPCAVAVKHATPCGVGVGGSICEAYLKAHDADPVSIFGGIVALNRICDTVTAEEMAKTHLDIIIAPGYTDEAIEVLTQKKNVRILALENICDPMPEGTLDFKKVQGGLLIQEADRTSFDPAALKIMTKREPTPGELESLDFAWRVCKHVKSNAIVLAADGRTSGIGPGQVNRFIAAEIAIRQAGERAKGSVMASDAFLPFCDCVEAAGAAGVTAIIQPGGSVRDRESIDKADELGIAMVFTGERHFKH

📊 Sample Types

Isolate 19.2%
Metagenome 80.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.1%
Termitidae 32.9%
Kalotermitidae 14.3%
Formicidae 7.1%
Termopsidae 4.3%
Rhinotermitidae 1.4%
Hodotermitidae 1.4%
Ixodidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
2 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
3 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
4 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2603880173 Pseudomonas SP. Isolate Unclassified
7 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
8 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
9 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
20 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
21 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
28 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
31 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
34 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
39 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
50 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
51 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
52 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
53 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
57 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
58 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
59 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
60 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
63 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
64 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
65 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
66 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
67 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
70 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
71 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_167311 3300042601 Bacteria 8965
2 Ga0466697_019925 3300042611 Bacteria 8332
3 Ga0123355_10022625 3300009826 Bacteria 10078
4 Ga0123356_10000001 3300010049 Bacteria 411946
5 Ga0123356_10003072 3300010049 Bacteria 17631
6 Ga0123356_10008458 3300010049 Bacteria 10232
7 Ga0123353_10050804 3300010167 Bacteria 6614
8 Ga0123353_10157802 3300010167 Bacteria 3614
9 Ga0466711_285127 3300042615 Bacteria 62198
10 Ga0466723_270019 3300042618 Bacteria 3048
11 Ga0466728_258451 3300042620 Bacteria 22159
12 Ga0415639_003695 3300038395 Bacteria 27560
13 Ga0466729_314796 3300042621 Bacteria 6779
14 Ga0466704_312129 3300042643 Bacteria 70462
15 Ga0466704_604528 3300042643 Bacteria 13454
16 Ga0466727_172755 3300042655 Bacteria 3601
17 JGI24702J35022_10000489 3300002462 Bacteria 23998
18 Ga0072941_1239139 3300005201 Bacteria 4155
19 Ga0466733_145568 3300042659 Bacteria 8857
20 Ga0466714_147954 3300042603 Bacteria 24894
21 Ga0123357_10091958 3300009784 Bacteria 3948
22 Ga0123355_10001249 3300009826 Unclassified 35457
23 Ga0123356_10002388 3300010049 Bacteria 20100
24 Ga0123353_10000717 3300010167 Bacteria 40404
25 Ga0123353_10018060 3300010167 Bacteria 10408
26 Ga0123353_10022021 3300010167 Bacteria 9589
27 Ga0123353_10406522 3300010167 Bacteria 2024
28 Ga0123354_10044176 3300010882 Bacteria 6838
29 Ga0466705_437942 3300042612 Bacteria 13406
30 Ga0466711_261053 3300042615 Bacteria 39528
31 Ga0466703_119440 3300042636 Bacteria 3416
32 JGI24702J35022_10038433 3300002462 Bacteria 2555
33 JGI24705J35276_12238804 3300002504 Bacteria 106703
34 Ga0466700_390130 3300042600 Bacteria 4593
35 Ga0123353_10000970 3300010167 Bacteria 35107
36 Ga0466715_451370 3300042616 Bacteria 5074
37 Ga0466723_116116 3300042618 Unclassified 8724
38 Ga0466726_215447 3300042619 Bacteria 6683
39 Ga0415639_001400 3300038395 Bacteria 43729
40 Ga0415639_056686 3300038395 Bacteria 5266
41 Ga0466731_195536 3300042622 Bacteria 24605
42 JGI24702J35022_10000078 3300002462 Bacteria 42674
43 JGI24696J40584_12961537 3300002834 Bacteria 20161
44 CVPL005W_1000568 3300002934 Bacteria 13919
45 Ga0103261_1001391 3300007083 Unclassified 3862
46 Ga0103264_1001400 3300007188 Bacteria 10601
47 Ga0466701_067390 3300042598 Bacteria 13666
48 Ga0466713_119761 3300042602 Bacteria 47658
49 Ga0466714_005312 3300042603 Bacteria 30939
50 Ga0123356_10081001 3300010049 Bacteria 3070
51 Ga0466710_256075 3300042613 Bacteria 2408
52 Ga0415639_033766 3300038395 Bacteria 11394
53 Ga0466696_067032 3300042596 Bacteria 12054
54 Ga0068305_10142877 3300005083 Unclassified 8273
55 Ga0466705_171514 3300042612 Bacteria 66002
56 Ga0466705_285876 3300042612 Bacteria 3201
57 Ga0466732_176116 3300042656 Bacteria 2342
58 Ga0466716_084081 3300042605 Bacteria 6891
59 Ga0123355_10094035 3300009826 Bacteria 4743
60 Ga0123356_10005206 3300010049 Bacteria 13295
61 Ga0123356_10170654 3300010049 Bacteria 2185
62 Ga0466715_202163 3300042616 Bacteria 11731
63 Ga0466723_214381 3300042618 Bacteria 4670
64 Ga0466693_122129 3300042592 Bacteria 2209
65 Ga0466735_052889 3300042624 Bacteria 3930
66 Ga0466735_088935 3300042624 Bacteria 3132
67 Ga0466702_144479 3300042635 Bacteria 15823
68 Ga0466703_175180 3300042636 Bacteria 33044
69 Ga0466697_142393 3300042611 Bacteria 2035
70 Ga0466714_155166 3300042603 Bacteria 6029
71 Ga0466714_157011 3300042603 Bacteria 21234
72 Ga0123357_10021525 3300009784 Bacteria 8633
73 Ga0466710_174897 3300042613 Bacteria 1724
74 Ga0415639_002947 3300038395 Bacteria 16843
75 Ga0466730_045222 3300042625 Bacteria 4555
76 Ga0466704_278504 3300042643 Bacteria 29381
77 Ga0466724_14567 3300042649 Bacteria 3755
78 JGI24705J35276_12224769 3300002504 Bacteria 2646
79 Ga0466701_048211 3300042598 Bacteria 18382
80 Ga0466706_132633 3300042599 Bacteria 1878
81 Ga0466700_349095 3300042600 Bacteria 27617
82 Ga0466719_149752 3300042606 Bacteria 9684
83 Ga0123356_10024470 3300010049 Bacteria 5681
84 Ga0123353_10223367 3300010167 Bacteria 2943
85 Ga0123354_10000432 3300010882 Bacteria 40956
86 Ga0466694_309797 3300042594 Bacteria 26951
87 Ga0466702_176719 3300042635 Bacteria 7033
88 Ga0466703_314665 3300042636 Bacteria 6981
89 Ga0068305_10031778 3300005083 Bacteria 28053
90 Ga0123357_10078493 3300009784 Bacteria 4350
91 Ga0123356_10039927 3300010049 Bacteria 4372
92 Ga0123353_10010671 3300010167 Bacteria 12839
93 Ga0123353_10341484 3300010167 Unclassified 2261
94 Ga0415639_013522 3300038395 Bacteria 6785
95 Ga0415639_037948 3300038395 Bacteria 12417
96 Ga0415639_052004 3300038395 Bacteria 6052
97 Ga0466657_018508 3300042582 Bacteria 12026
98 Ga0466704_226850 3300042643 Bacteria 16106
99 Ga0103266_1000042 3300007067 Bacteria 115372
100 Ga0102737_1005095 3300007142 Bacteria 2672
101 Ga0103264_1000704 3300007188 Bacteria 15873

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_309797 Ga0466694_309797_25485_26885 466
2 3300038395 Ga0415639_056686 Ga0415639_056686_2653_4191 488
3 3300038395 Ga0415639_013522 Ga0415639_013522_2929_4398 489
4 3300038395 Ga0415639_002947 Ga0415639_002947_314_1792 492
5 3300042612 Ga0466705_437942 Ga0466705_437942_9060_10538 492
6 3300042618 Ga0466723_214381 Ga0466723_214381_1154_2632 492
7 3300042636 Ga0466703_175180 Ga0466703_175180_8770_10248 492
8 3300042643 Ga0466704_604528 Ga0466704_604528_8132_9685 492
9 3300042618 Ga0466723_270019 Ga0466723_270019_1027_2514 495
10 3300009784 Ga0123357_10021525 Ga0123357_100215254 496
11 3300010049 Ga0123356_10039927 Ga0123356_100399272 496
12 3300009784 Ga0123357_10078493 Ga0123357_100784933 497
13 3300042613 Ga0466710_174897 Ga0466710_174897_62_1627 499
14 3300042615 Ga0466711_285127 Ga0466711_285127_38081_39580 499
15 3300042655 Ga0466727_172755 Ga0466727_172755_1579_3117 500
16 3300009826 Ga0123355_10022625 Ga0123355_100226256 505
17 3300010167 Ga0123353_10000717 Ga0123353_1000071712 506
18 3300042603 Ga0466714_005312 Ga0466714_005312_8452_9993 506
19 3300010882 Ga0123354_10044176 Ga0123354_100441764 507
20 3300042615 Ga0466711_261053 Ga0466711_261053_21176_22729 507
21 iso_pr_bacteria 2820249082 2820249207 507
22 3300010167 Ga0123353_10341484 Ga0123353_103414842 508
23 3300042603 Ga0466714_157011 Ga0466714_157011_19322_20863 508
24 3300042625 Ga0466730_045222 Ga0466730_045222_1102_2631 509
25 iso_pr_bacteria 2820477775 2820478921 509
26 3300042603 Ga0466714_155166 Ga0466714_155166_685_2217 510
27 3300042624 Ga0466735_088935 Ga0466735_088935_90_1622 510
28 3300042635 Ga0466702_144479 Ga0466702_144479_11672_13204 510
29 3300042635 Ga0466702_176719 Ga0466702_176719_831_2363 510
30 3300042612 Ga0466705_285876 Ga0466705_285876_480_2015 511
31 3300042616 Ga0466715_451370 Ga0466715_451370_1210_2745 511
32 3300042620 Ga0466728_258451 Ga0466728_258451_15193_16728 511
33 3300042621 Ga0466729_314796 Ga0466729_314796_4383_5918 511
34 3300042624 Ga0466735_052889 Ga0466735_052889_2295_3830 511
35 3300042636 Ga0466703_119440 Ga0466703_119440_1207_2742 511
36 3300042643 Ga0466704_278504 Ga0466704_278504_21628_23163 511
37 3300042659 Ga0466733_145568 Ga0466733_145568_3600_5135 511
38 3300005083 Ga0068305_10031778 Ga0068305_1003177817 512
39 3300010167 Ga0123353_10406522 Ga0123353_104065221 512
40 3300038395 Ga0415639_001400 Ga0415639_001400_31030_32568 512
41 3300038395 Ga0415639_003695 Ga0415639_003695_9825_11363 512
42 3300038395 Ga0415639_033766 Ga0415639_033766_3468_5006 512
43 3300038395 Ga0415639_052004 Ga0415639_052004_3678_5216 512
44 3300042582 Ga0466657_018508 Ga0466657_018508_5835_7373 512
45 3300042596 Ga0466696_067032 Ga0466696_067032_1400_2938 512
46 3300042598 Ga0466701_048211 Ga0466701_048211_123_1661 512
47 3300042598 Ga0466701_067390 Ga0466701_067390_9388_10926 512
48 3300042600 Ga0466700_349095 Ga0466700_349095_207_1745 512
49 3300042600 Ga0466700_390130 Ga0466700_390130_1676_3214 512
50 3300042601 Ga0466707_167311 Ga0466707_167311_4489_6027 512
51 3300042606 Ga0466719_149752 Ga0466719_149752_6073_7611 512
52 3300042611 Ga0466697_019925 Ga0466697_019925_5996_7534 512
53 3300042611 Ga0466697_142393 Ga0466697_142393_32_1570 512
54 3300042613 Ga0466710_256075 Ga0466710_256075_143_1681 512
55 3300042622 Ga0466731_195536 Ga0466731_195536_12345_13883 512
56 3300042643 Ga0466704_312129 Ga0466704_312129_6669_8207 512
57 3300042649 Ga0466724_14567 Ga0466724_14567_1785_3323 512
58 3300042656 Ga0466732_176116 Ga0466732_176116_648_2186 512
59 iso_pr_bacteria 2820261600 2820262547 512
60 iso_pr_bacteria 2820292184 2820293305 512
61 iso_pr_bacteria 2820342392 2820342477 512
62 iso_pr_bacteria 2820735654 2820735875 512
63 iso_pr_bacteria 2820753519 2820754721 512
64 iso_pr_bacteria 2820755292 2820756133 512
65 iso_pr_bacteria 2820792843 2820793119 512
66 iso_pr_bacteria 2820795054 2820797130 512
67 iso_pr_bacteria 2820797595 2820798451 512
68 3300002462 JGI24702J35022_10000489 JGI24702J35022_1000048918 513
69 3300002462 JGI24702J35022_10038433 JGI24702J35022_100384332 513
70 3300002504 JGI24705J35276_12224769 JGI24705J35276_122247692 513
71 3300002834 JGI24696J40584_12961537 JGI24696J40584_1296153718 513
72 3300005083 Ga0068305_10142877 Ga0068305_101428773 513
73 3300005201 Ga0072941_1239139 Ga0072941_12391393 513
74 3300010049 Ga0123356_10000001 Ga0123356_10000001196 513
75 3300010049 Ga0123356_10005206 Ga0123356_100052069 513
76 3300010049 Ga0123356_10024470 Ga0123356_100244702 513
77 3300010167 Ga0123353_10000970 Ga0123353_1000097026 513
78 3300010167 Ga0123353_10010671 Ga0123353_100106719 513
79 3300010167 Ga0123353_10050804 Ga0123353_100508044 513
80 3300010167 Ga0123353_10157802 Ga0123353_101578022 513
81 3300042602 Ga0466713_119761 Ga0466713_119761_25697_27241 514
82 3300042605 Ga0466716_084081 Ga0466716_084081_710_2260 516
83 3300042636 Ga0466703_314665 Ga0466703_314665_1099_2703 516
84 3300010167 Ga0123353_10022021 Ga0123353_100220213 518
85 3300042592 Ga0466693_122129 Ga0466693_122129_605_2161 518
86 3300042612 Ga0466705_171514 Ga0466705_171514_41589_43145 518
87 3300042616 Ga0466715_202163 Ga0466715_202163_5019_6575 518
88 3300042618 Ga0466723_116116 Ga0466723_116116_1999_3555 518
89 iso_pr_bacteria 2754412482 2755214941 518
90 iso_pr_bacteria 2754412483 2755216645 518
91 iso_pr_bacteria 2772190889 2773432007 518
92 iso_pr_bacteria 2772190892 2773436400 518
93 iso_pr_bacteria 2772190893 2773438101 518
94 iso_pr_bacteria 2772190894 2773438857 518
95 3300002462 JGI24702J35022_10000078 JGI24702J35022_1000007826 519
96 3300002504 JGI24705J35276_12238804 JGI24705J35276_1223880490 519
97 3300009784 Ga0123357_10091958 Ga0123357_100919583 519
98 3300010049 Ga0123356_10170654 Ga0123356_101706542 519
99 3300010882 Ga0123354_10000432 Ga0123354_1000043217 519
100 iso_pr_bacteria 2599185121 2599225042 519
101 iso_pr_bacteria 2603880173 2606036632 519
102 iso_pr_bacteria 2820075487 2820076564 519
103 3300002934 CVPL005W_1000568 CVPL005W_10005682 520
104 3300007083 Ga0103261_1001391 Ga0103261_10013912 520
105 3300007142 Ga0102737_1005095 Ga0102737_10050953 520
106 3300010049 Ga0123356_10081001 Ga0123356_100810012 520
107 3300010167 Ga0123353_10018060 Ga0123353_100180607 520
108 3300042599 Ga0466706_132633 Ga0466706_132633_184_1749 521
109 iso_pr_bacteria 2687453754 2690040736 522
110 iso_pr_bacteria 2687453755 2690045169 522
111 iso_pr_bacteria 2687453756 2690047182 522
112 3300007188 Ga0103264_1001400 Ga0103264_100140011 523
113 3300007067 Ga0103266_1000042 Ga0103266_10000423 524
114 3300007188 Ga0103264_1000704 Ga0103264_100070411 524
115 3300042619 Ga0466726_215447 Ga0466726_215447_3639_5216 525
116 3300010049 Ga0123356_10008458 Ga0123356_100084586 528
117 3300010167 Ga0123353_10223367 Ga0123353_102233672 528
118 3300042643 Ga0466704_226850 Ga0466704_226850_4228_5814 528
119 3300009826 Ga0123355_10001249 Ga0123355_100012493 533
120 3300010049 Ga0123356_10002388 Ga0123356_1000238815 533
121 3300009826 Ga0123355_10094035 Ga0123355_100940355 535
122 iso_pr_bacteria 2820931684 2820931703 537
123 3300010049 Ga0123356_10003072 Ga0123356_100030725 538
124 3300042603 Ga0466714_147954 Ga0466714_147954_605_2245 546
125 3300038395 Ga0415639_037948 Ga0415639_037948_3117_4934 605

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme 227 539 0.98
PF02142 MGS MGS-like domain 108 221 0.96
PF13353 Fer4_12 4Fe-4S single cluster domain 6 91 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.