Protein Family IF04272

Metagenome Metatranscriptome Isolate
326 Members
210 Samples
196 Scaffolds
121.35 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_003328|Ga0415639_003328_2418_2819
Length
133 aa
Sequence
MVCLYEKEVSPVIQQESTLRVADNTGAKELKCIRVLGGSGRRYAGVGDVVVCSVRRANPGGTAKKGEVVKAVIVRTVKGIHRQDGSYVRFDENAAVIIKEDKNPRGTRIFGPVARELRDKDYMKILSLAPEVI

πŸ“Š Sample Types

Isolate 39.9%
Metagenome 59.8%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 35.2%
Termitidae 20.6%
Apidae 15.6%
Kalotermitidae 5.0%
Scarabaeidae 3.5%
Formicidae 3.0%
Cambaridae 2.0%
Armadillidiidae 2.0%
Tenebrionidae 2.0%
Termopsidae 1.5%
Culicidae 1.5%
Rhinotermitidae 1.0%
Curculionidae 1.0%
Hydrophilidae 1.0%
Passalidae 1.0%
Calliphoridae 0.5%
Hodotermitidae 0.5%
Rhaphidophoridae 0.5%
Siricidae 0.5%
Pyralidae 0.5%
Pentatomidae 0.5%
Cerambycidae 0.5%
Dytiscidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 292
Eukaryota 0
Viruses 0
Unclassified 34

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
2 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
3 2896955351 Streptomyces sp. GF20 Isolate Termitidae
4 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
5 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
6 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
7 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
8 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
9 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
10 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
11 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
12 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
13 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
14 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
15 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
16 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
17 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
26 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
27 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
28 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
33 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
36 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
37 3004719924 Lactobacillus sp. W8174 Isolate Apidae
38 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
39 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
40 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
41 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
42 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
43 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
44 2505679068 Isoptericola variabilis 225 Isolate Unclassified
45 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
46 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
47 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
48 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
49 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
50 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
51 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
52 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
53 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
54 8062637095 Yimella sp. cx-51 Isolate Cambaridae
55 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
56 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
59 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
60 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
61 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
62 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
63 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
64 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
65 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
66 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
67 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
68 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
69 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
70 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
71 2504756063 Isoptericola variabilis J5 Isolate Unclassified
72 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
73 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
74 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
75 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
76 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
77 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
78 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
79 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
80 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
81 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
82 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
83 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
84 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
85 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
89 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
90 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
91 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
92 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
93 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
94 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
95 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
96 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
97 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
98 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
99 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
100 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
101 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
102 2568526170 Bifidobacterium sp. A11 Isolate Apidae
103 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
104 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
105 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
106 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
107 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
108 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
109 2820634724 Unclassified Firmicutes Emb289P1bin116 Isolate Unclassified
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
112 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
113 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
114 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
115 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
116 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
117 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
118 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
119 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
120 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
121 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
122 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
123 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
124 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
125 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
126 2862784999 Streptomyces sp. M41 Isolate Unclassified
127 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
128 2909412500 Yimella sp. cx-573 Isolate Cambaridae
129 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
130 2931425734 Nocardioides sp. J2M5 Isolate
131 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
132 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
133 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
134 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
135 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
136 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
137 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
138 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
139 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
140 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
141 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
142 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
143 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
144 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
145 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
146 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
147 2912749649 Streptomyces sp. GS7 Isolate Termitidae
148 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
149 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
150 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
151 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
152 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
153 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
154 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
155 3006461590 Streptomyces sp. RB5 Isolate Termitidae
156 3006667155 Streptomyces sp. SID9727 Isolate
157 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
158 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
159 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
160 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
161 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
162 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
163 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
164 2908241010 Streptomyces sp. HF10 Isolate Termitidae
165 2912817845 Streptomyces griseus SID164 Isolate
166 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
167 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
168 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
169 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
170 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
171 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
172 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
173 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
174 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
175 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
176 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
177 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
178 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
179 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
180 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
181 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
182 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
183 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
184 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
185 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
186 3006468911 Streptomyces sp. RB17 Isolate Termitidae
187 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
188 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
189 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
190 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
191 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
192 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
193 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
194 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
195 2547132081 Streptomyces sp. S4 Isolate Formicidae
196 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
197 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
198 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
199 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
200 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
201 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
202 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
203 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
204 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
205 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
206 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
207 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
208 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
209 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
210 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160440_103450 3300012815 Unclassified 1539
2 Ga0160458_120408 3300012832 Bacteria 686
3 Ga0160433_104418 3300012846 Bacteria 2267
4 Ga0160430_100932 3300012852 Unclassified 12770
5 Ga0160457_1002026 3300012858 Bacteria 4717
6 Ga0264413_148735 3300024493 Bacteria 1322
7 Ga0415639_201838 3300038395 Bacteria 1573
8 Ga0123355_10155645 3300009826 Bacteria 3459
9 Ga0123355_10526999 3300009826 Bacteria 1442
10 Ga0123355_10622984 3300009826 Bacteria 1271
11 Ga0123356_12338992 3300010049 Bacteria 668
12 Ga0123353_10000033 3300010167 Bacteria 150421
13 Ga0123353_11665883 3300010167 Unclassified 801
14 Ga0466732_081474 3300042656 Bacteria 1830
15 Ga0562378_0727 3300056814 Bacteria 47065
16 Ga0562375_1322 3300056856 Bacteria 34684
17 Ga0466714_084576 3300042603 Bacteria 3015
18 Ga0466718_024425 3300042617 Bacteria 5596
19 Ga0466728_141395 3300042620 Bacteria 18755
20 Ga0466729_100000 3300042621 Bacteria 2809
21 IMNBL1DRAFT_c0000426 3300000062 Bacteria 35421
22 JGI24697J35500_11090288 3300002507 Unclassified 1136
23 JGI24697J35500_11270675 3300002507 Bacteria 4279
24 Ga0068302_10000197 3300005071 Bacteria 28753
25 Ga0072940_1088022 3300005200 Bacteria 763
26 Ga0072941_1007162 3300005201 Bacteria 33370
27 Ga0072941_1096920 3300005201 Bacteria 13635
28 Ga0466734_118088 3300042623 Unclassified 1005
29 Ga0466702_061334 3300042635 Bacteria 1101
30 Ga0466702_286161 3300042635 Bacteria 2694
31 Ga0466709_014700 3300042648 Bacteria 1762
32 Ga0466724_27243 3300042649 Bacteria 6777
33 Ga0466725_462654 3300042654 Bacteria 3181
34 Ga0160456_100878 3300012820 Bacteria 8059
35 Ga0160446_100672 3300012835 Unclassified 11712
36 Ga0123357_10293049 3300009784 Bacteria 1658
37 Ga0123356_10778552 3300010049 Unclassified 1127
38 Ga0123353_10233784 3300010167 Bacteria 2863
39 Ga0123353_11989615 3300010167 Bacteria 712
40 Ga0123354_10943630 3300010882 Unclassified 561
41 Ga0466732_246010 3300042656 Bacteria 4220
42 Ga0466706_042959 3300042599 Bacteria 1607
43 Ga0466706_162915 3300042599 Bacteria 17654
44 Ga0466707_273021 3300042601 Bacteria 1834
45 Ga0466721_007819 3300042608 Bacteria 1478
46 Ga0466718_016351 3300042617 Bacteria 1635
47 AustNasuHG_c1005636 3300000089 Bacteria 4480
48 HBC_ctgsDRAFT_1113527 3300000333 Bacteria 618
49 JGI24702J35022_10308613 3300002462 Unclassified 935
50 Ga0111035_103226 3300007901 Unclassified 17000
51 Ga0466704_212812 3300042643 Bacteria 35602
52 Ga0466727_142534 3300042655 Bacteria 55597
53 Ga0160432_103527 3300012818 Bacteria 2270
54 Ga0255572_1000839 3300026175 Bacteria 31625
55 Ga0123355_10000553 3300009826 Bacteria 50067
56 Ga0123355_10382865 3300009826 Bacteria 1831
57 Ga0123355_10645486 3300009826 Bacteria 1237
58 Ga0123356_10036140 3300010049 Bacteria 4613
59 Ga0123353_11684442 3300010167 Bacteria 795
60 Ga0123353_12868983 3300010167 Bacteria 563
61 Ga0466705_175607 3300042612 Bacteria 1688
62 Ga0466705_340721 3300042612 Bacteria 18791
63 Ga0466706_157549 3300042599 Bacteria 1176
64 Ga0466714_006340 3300042603 Bacteria 2455
65 Ga0466717_289737 3300042604 Bacteria 1024
66 Ga0466718_147760 3300042617 Bacteria 2725
67 Ga0466723_247108 3300042618 Bacteria 1248
68 Ga0466726_380182 3300042619 Bacteria 2232
69 JGI24702J35022_10003607 3300002462 Bacteria 9318
70 JGI24702J35022_10411313 3300002462 Unclassified 818
71 Ga0072940_1088023 3300005200 Bacteria 3651
72 Ga0466731_092788 3300042622 Bacteria 1039
73 Ga0466731_213194 3300042622 Bacteria 1004
74 Ga0415639_003328 3300038395 Bacteria 4857
75 Ga0123355_10458983 3300009826 Bacteria 1600
76 Ga0123356_10056246 3300010049 Unclassified 3665
77 Ga0123353_10000701 3300010167 Bacteria 40961
78 Ga0123353_10215284 3300010167 Bacteria 3009
79 Ga0123353_10753410 3300010167 Bacteria 1355
80 Ga0123354_10182293 3300010882 Bacteria 2391
81 Ga0160466_100074 3300012809 Bacteria 108538
82 Ga0466706_002456 3300042599 Bacteria 2081
83 Ga0466706_118801 3300042599 Bacteria 2908
84 Ga0466706_156127 3300042599 Unclassified 1503
85 Ga0466707_217817 3300042601 Bacteria 5144
86 Ga0466707_380438 3300042601 Unclassified 2537
87 Ga0466720_040299 3300042607 Bacteria 13637
88 Ga0466718_015454 3300042617 Unclassified 1688
89 Ga0466728_240430 3300042620 Bacteria 19472
90 IMNBL1DRAFT_c0024154 3300000062 Bacteria 2363
91 JGI24695J34938_10061783 3300002450 Unclassified 1593
92 JGI24700J35501_10924065 3300002508 Bacteria 5357
93 Ga0072940_1324024 3300005200 Bacteria 1638
94 Ga0072941_1012258 3300005201 Bacteria 37649
95 Ga0466727_131483 3300042655 Bacteria 12506
96 Ga0466695_105696 3300042595 Bacteria 11270
97 Ga0123355_10004431 3300009826 Bacteria 20424
98 Ga0123355_10197417 3300009826 Unclassified 2948
99 Ga0123355_10529157 3300009826 Bacteria 1437
100 Ga0123356_10803187 3300010049 Unclassified 1112
101 Ga0123356_13483874 3300010049 Bacteria 545
102 Ga0123353_10251636 3300010167 Bacteria 2736
103 Ga0123353_10951934 3300010167 Bacteria 1161
104 Ga0123353_12192902 3300010167 Unclassified 669
105 Ga0123354_11006874 3300010882 Bacteria 536
106 Ga0562375_0080 3300056856 Bacteria 309561
107 Ga0590775_17304 3300060896 Bacteria 972
108 Ga0466706_191347 3300042599 Bacteria 11530
109 Ga0466700_084450 3300042600 Bacteria 4684
110 Ga0466707_243360 3300042601 Bacteria 29608
111 Ga0466713_025156 3300042602 Bacteria 41607
112 Ga0466714_041056 3300042603 Bacteria 12167
113 Ga0466714_117100 3300042603 Bacteria 1989
114 Ga0466714_135898 3300042603 Bacteria 7216
115 Ga0466716_404377 3300042605 Bacteria 3858
116 Ga0466718_142434 3300042617 Bacteria 1255
117 Ga0466726_353337 3300042619 Bacteria 59989
118 Ga0466729_159705 3300042621 Bacteria 9059
119 JGI24702J35022_10168039 3300002462 Bacteria 1239
120 JGI24705J35276_12219518 3300002504 Bacteria 2209
121 Ga0466729_287045 3300042621 Bacteria 99069
122 Ga0466730_086863 3300042625 Bacteria 4535
123 Ga0466724_52014 3300042649 Bacteria 5428
124 Ga0466725_212446 3300042654 Bacteria 2282
125 Ga0160453_109690 3300012814 Unclassified 1126
126 Ga0160440_100031 3300012815 Bacteria 222224
127 Ga0160448_117245 3300012854 Bacteria 1251
128 Ga0160457_1022964 3300012858 Unclassified 871
129 Ga0415639_118637 3300038395 Bacteria 1108
130 Ga0466657_291877 3300042582 Bacteria 2136
131 Ga0466693_352912 3300042592 Bacteria 1341
132 Ga0123353_10075100 3300010167 Bacteria 5433
133 Ga0123353_10393883 3300010167 Bacteria 2065
134 Ga0123353_10755298 3300010167 Bacteria 1353
135 Ga0123353_11624119 3300010167 Bacteria 815
136 Ga0123353_12017310 3300010167 Unclassified 706
137 Ga0466733_195136 3300042659 Bacteria 1120
138 Ga0562379_4734 3300056790 Bacteria 6255
139 Ga0466706_223170 3300042599 Bacteria 11130
140 Ga0466717_090331 3300042604 Unclassified 1163
141 Ga0466698_081315 3300042610 Bacteria 1176
142 Ga0466728_425423 3300042620 Bacteria 1987
143 2227603793 2225789004 Bacteria 2315
144 IMNBL1DRAFT_c0025280 3300000062 Bacteria 2281
145 AustNasuHG_c1001775 3300000089 Bacteria 7810
146 JGI24702J35022_10012448 3300002462 Bacteria 4730
147 Ga0072940_1097075 3300005200 Bacteria 2891
148 Ga0466730_011725 3300042625 Bacteria 8736
149 Ga0466724_66581 3300042649 Bacteria 665985
150 Ga0255572_1000024 3300026175 Bacteria 128087
151 Ga0255575_1000023 3300026559 Bacteria 88290
152 Ga0415639_106168 3300038395 Bacteria 2412
153 Ga0466656_238355 3300042550 Unclassified 1201
154 Ga0123357_10748372 3300009784 Bacteria 680
155 Ga0123355_10647649 3300009826 Bacteria 1234
156 Ga0123355_11077843 3300009826 Unclassified 840
157 Ga0123356_10076917 3300010049 Bacteria 3146
158 Ga0123353_10008423 3300010167 Bacteria 14077
159 Ga0123353_10172445 3300010167 Unclassified 3432
160 Ga0123353_10974117 3300010167 Unclassified 1143
161 Ga0123353_11187036 3300010167 Bacteria 1003
162 Ga0160442_100131 3300012806 Unclassified 75763
163 Ga0562375_3766 3300056856 Bacteria 13275
164 Ga0466706_235654 3300042599 Bacteria 1252
165 Ga0466713_014023 3300042602 Bacteria 32520
166 Ga0466716_537488 3300042605 Bacteria 1127
167 Ga0466719_236594 3300042606 Bacteria 21995
168 Ga0466715_502498 3300042616 Bacteria 2293
169 Ga0466729_156052 3300042621 Bacteria 12586
170 JGI24703J35330_11739032 3300002501 Bacteria 3256
171 JGI24696J40584_12931166 3300002834 Bacteria 1481
172 Ga0074263_101665 3300005485 Bacteria 1391
173 Ga0466730_042836 3300042625 Bacteria 1478
174 Ga0466704_388961 3300042643 Unclassified 3106
175 Ga0466725_323925 3300042654 Bacteria 1157
176 Ga0160469_100487 3300012824 Bacteria 17913
177 Ga0466691_093383 3300042593 Bacteria 2844
178 Ga0466696_219591 3300042596 Bacteria 1698
179 Ga0123353_10374306 3300010167 Unclassified 2133
180 Ga0123353_11046961 3300010167 Bacteria 1090
181 Ga0123353_11096448 3300010167 Bacteria 1057
182 Ga0466706_152357 3300042599 Unclassified 3521
183 Ga0466706_265212 3300042599 Bacteria 1909
184 Ga0466707_166123 3300042601 Bacteria 25982
185 Ga0466716_077310 3300042605 Bacteria 14234
186 Ga0466722_257879 3300042609 Bacteria 4212
187 Ga0466710_153421 3300042613 Bacteria 1718
188 Ga0466718_043698 3300042617 Bacteria 5639
189 JGI24696J40584_12640608 3300002834 Bacteria 686
190 Ga0068305_10005402 3300005083 Bacteria 29409
191 Ga0072940_1294333 3300005200 Bacteria 1016
192 Ga0466729_258952 3300042621 Unclassified 1536
193 Ga0466734_107278 3300042623 Bacteria 1989
194 Ga0466730_004134 3300042625 Unclassified 2559
195 Ga0466725_065857 3300042654 Bacteria 1224
196 Ga0466725_436319 3300042654 Unclassified 1118

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_142434 Ga0466718_142434_849_1217 108
2 3300042649 Ga0466724_52014 Ga0466724_52014_3411_3779 108
3 3300000089 AustNasuHG_c1005636 AustNasuHG_10056368 109
4 3300010167 Ga0123353_10233784 Ga0123353_102337845 109
5 3300009826 Ga0123355_10155645 Ga0123355_101556458 110
6 3300042623 Ga0466734_118088 Ga0466734_118088_298_666 110
7 3300042649 Ga0466724_66581 Ga0466724_66581_161340_161708 110
8 3300042654 Ga0466725_436319 Ga0466725_436319_364_732 110
9 3300056856 Ga0562375_1322 Ga0562375_1322_2131_2499 110
10 3300009826 Ga0123355_10645486 Ga0123355_106454862 111
11 3300010167 Ga0123353_10215284 Ga0123353_102152842 111
12 3300042582 Ga0466657_291877 Ga0466657_291877_1435_1803 111
13 3300042625 Ga0466730_042836 Ga0466730_042836_1048_1416 111
14 3300042599 Ga0466706_265212 Ga0466706_265212_408_767 112
15 3300042618 Ga0466723_247108 Ga0466723_247108_34_372 112
16 3300042620 Ga0466728_425423 Ga0466728_425423_1621_1962 113
17 3300042643 Ga0466704_388961 Ga0466704_388961_647_1015 113
18 3300010167 Ga0123353_10393883 Ga0123353_103938834 114
19 3300042599 Ga0466706_223170 Ga0466706_223170_2125_2493 114
20 3300010167 Ga0123353_10172445 Ga0123353_101724454 115
21 3300038395 Ga0415639_118637 Ga0415639_118637_145_492 115
22 3300042602 Ga0466713_014023 Ga0466713_014023_14770_15117 115
23 3300042621 Ga0466729_159705 Ga0466729_159705_5290_5637 115
24 3300042622 Ga0466731_092788 Ga0466731_092788_391_738 115
25 3300042625 Ga0466730_004134 Ga0466730_004134_849_1217 115
26 3300010049 Ga0123356_10056246 Ga0123356_100562466 116
27 3300010049 Ga0123356_10778552 Ga0123356_107785523 116
28 3300010049 Ga0123356_10803187 Ga0123356_108031871 116
29 3300010167 Ga0123353_10251636 Ga0123353_102516364 116
30 3300010167 Ga0123353_10374306 Ga0123353_103743063 116
31 3300010882 Ga0123354_10182293 Ga0123354_101822933 116
32 3300042617 Ga0466718_015454 Ga0466718_015454_650_1000 116
33 3300010167 Ga0123353_11624119 Ga0123353_116241192 117
34 3300010167 Ga0123353_11989615 Ga0123353_119896151 117
35 3300042613 Ga0466710_153421 Ga0466710_153421_927_1286 119
36 2225789004 2227603793 2228171297 122
37 3300009784 Ga0123357_10293049 Ga0123357_102930493 122
38 3300024493 Ga0264413_148735 Ga0264413_1487352 122
39 3300026175 Ga0255572_1000024 Ga0255572_100002491 122
40 3300026175 Ga0255572_1000839 Ga0255572_100083920 122
41 3300026559 Ga0255575_1000023 Ga0255575_100002360 122
42 3300038395 Ga0415639_201838 Ga0415639_201838_675_1043 122
43 3300042550 Ga0466656_238355 Ga0466656_238355_230_598 122
44 3300042592 Ga0466693_352912 Ga0466693_352912_653_1021 122
45 3300042593 Ga0466691_093383 Ga0466691_093383_484_852 122
46 3300042595 Ga0466695_105696 Ga0466695_105696_1534_1902 122
47 3300042596 Ga0466696_219591 Ga0466696_219591_800_1168 122
48 3300042599 Ga0466706_002456 Ga0466706_002456_894_1262 122
49 3300042599 Ga0466706_042959 Ga0466706_042959_668_1036 122
50 3300042599 Ga0466706_118801 Ga0466706_118801_401_769 122
51 3300042599 Ga0466706_152357 Ga0466706_152357_1191_1559 122
52 3300042599 Ga0466706_156127 Ga0466706_156127_751_1119 122
53 3300042599 Ga0466706_157549 Ga0466706_157549_506_874 122
54 3300042599 Ga0466706_162915 Ga0466706_162915_7092_7460 122
55 3300042599 Ga0466706_191347 Ga0466706_191347_5500_5868 122
56 3300042599 Ga0466706_235654 Ga0466706_235654_618_986 122
57 3300042600 Ga0466700_084450 Ga0466700_084450_3195_3563 122
58 3300042601 Ga0466707_166123 Ga0466707_166123_14063_14431 122
59 3300042601 Ga0466707_217817 Ga0466707_217817_2663_3031 122
60 3300042601 Ga0466707_243360 Ga0466707_243360_5985_6353 122
61 3300042601 Ga0466707_273021 Ga0466707_273021_88_456 122
62 3300042601 Ga0466707_380438 Ga0466707_380438_515_883 122
63 3300042602 Ga0466713_025156 Ga0466713_025156_27740_28108 122
64 3300042603 Ga0466714_006340 Ga0466714_006340_1606_1974 122
65 3300042603 Ga0466714_041056 Ga0466714_041056_4774_5142 122
66 3300042603 Ga0466714_084576 Ga0466714_084576_1074_1442 122
67 3300042603 Ga0466714_117100 Ga0466714_117100_1317_1685 122
68 3300042603 Ga0466714_135898 Ga0466714_135898_758_1126 122
69 3300042604 Ga0466717_090331 Ga0466717_090331_17_385 122
70 3300042604 Ga0466717_289737 Ga0466717_289737_65_433 122
71 3300042605 Ga0466716_537488 Ga0466716_537488_148_516 122
72 3300042606 Ga0466719_236594 Ga0466719_236594_10927_11295 122
73 3300042607 Ga0466720_040299 Ga0466720_040299_6416_6784 122
74 3300042608 Ga0466721_007819 Ga0466721_007819_407_775 122
75 3300042609 Ga0466722_257879 Ga0466722_257879_254_622 122
76 3300042610 Ga0466698_081315 Ga0466698_081315_113_481 122
77 3300042612 Ga0466705_175607 Ga0466705_175607_681_1049 122
78 3300042612 Ga0466705_340721 Ga0466705_340721_12986_13354 122
79 3300042616 Ga0466715_502498 Ga0466715_502498_657_1025 122
80 3300042617 Ga0466718_016351 Ga0466718_016351_64_432 122
81 3300042617 Ga0466718_024425 Ga0466718_024425_260_628 122
82 3300042617 Ga0466718_043698 Ga0466718_043698_4522_4890 122
83 3300042617 Ga0466718_147760 Ga0466718_147760_838_1206 122
84 3300042619 Ga0466726_353337 Ga0466726_353337_15106_15474 122
85 3300042619 Ga0466726_380182 Ga0466726_380182_435_803 122
86 3300042621 Ga0466729_100000 Ga0466729_100000_168_536 122
87 3300042621 Ga0466729_156052 Ga0466729_156052_6246_6614 122
88 3300042621 Ga0466729_258952 Ga0466729_258952_399_767 122
89 3300042621 Ga0466729_287045 Ga0466729_287045_33486_33854 122
90 3300042622 Ga0466731_213194 Ga0466731_213194_586_954 122
91 3300042623 Ga0466734_107278 Ga0466734_107278_1069_1437 122
92 3300042625 Ga0466730_011725 Ga0466730_011725_956_1324 122
93 3300042635 Ga0466702_061334 Ga0466702_061334_522_890 122
94 3300042635 Ga0466702_286161 Ga0466702_286161_508_876 122
95 3300042643 Ga0466704_212812 Ga0466704_212812_24419_24787 122
96 3300042648 Ga0466709_014700 Ga0466709_014700_98_466 122
97 3300042649 Ga0466724_27243 Ga0466724_27243_860_1228 122
98 3300042654 Ga0466725_065857 Ga0466725_065857_788_1156 122
99 3300042654 Ga0466725_212446 Ga0466725_212446_1431_1799 122
100 3300042654 Ga0466725_323925 Ga0466725_323925_183_551 122
101 3300042654 Ga0466725_462654 Ga0466725_462654_1737_2105 122
102 3300042655 Ga0466727_131483 Ga0466727_131483_10628_10996 122
103 3300042655 Ga0466727_142534 Ga0466727_142534_32895_33263 122
104 3300042656 Ga0466732_081474 Ga0466732_081474_571_939 122
105 3300042656 Ga0466732_246010 Ga0466732_246010_1925_2293 122
106 3300042659 Ga0466733_195136 Ga0466733_195136_22_390 122
107 3300056790 Ga0562379_4734 Ga0562379_4734_4214_4582 122
108 3300056814 Ga0562378_0727 Ga0562378_0727_30873_31241 122
109 3300056856 Ga0562375_0080 Ga0562375_0080_207490_207858 122
110 3300056856 Ga0562375_3766 Ga0562375_3766_1142_1510 122
111 iso_pr_bacteria 2504756063 2504977501 122
112 iso_pr_bacteria 2505679068 2505951773 122
113 iso_pr_bacteria 2513237174 2514074439 122
114 iso_pr_bacteria 2515154100 2515556401 122
115 iso_pr_bacteria 2515154104 2515585752 122
116 iso_pr_bacteria 2515154106 2515606584 122
117 iso_pr_bacteria 2519899775 2520953332 122
118 iso_pr_bacteria 2523533511 2523591836 122
119 iso_pr_bacteria 2547132081 2547292692 122
120 iso_pr_bacteria 2568526170 2569119356 122
121 iso_pr_bacteria 2597490239 2598798887 122
122 iso_pr_bacteria 2600255079 2600868879 122
123 iso_pr_bacteria 2645727721 2646684816 122
124 iso_pr_bacteria 2648501322 2649445445 122
125 iso_pr_bacteria 2663763384 2666812644 122
126 iso_pr_bacteria 2681812870 2682010947 122
127 iso_pr_bacteria 2684622911 2686074175 122
128 iso_pr_bacteria 2684622912 2686075892 122
129 iso_pr_bacteria 2684622913 2686077777 122
130 iso_pr_bacteria 2684622914 2686079608 122
131 iso_pr_bacteria 2684622916 2686083214 122
132 iso_pr_bacteria 2684622918 2686086390 122
133 iso_pr_bacteria 2684622919 2686088159 122
134 iso_pr_bacteria 2684622920 2686089802 122
135 iso_pr_bacteria 2731957681 2732700052 122
136 iso_pr_bacteria 2734481968 2734843116 122
137 iso_pr_bacteria 2758568501 2760245767 122
138 iso_pr_bacteria 2758568502 2760247400 122
139 iso_pr_bacteria 2758568503 2760249062 122
140 iso_pr_bacteria 2758568504 2760250724 122
141 iso_pr_bacteria 2758568505 2760252352 122
142 iso_pr_bacteria 2758568506 2760254124 122
143 iso_pr_bacteria 2758568507 2760255653 122
144 iso_pr_bacteria 2758568508 2760257352 122
145 iso_pr_bacteria 2758568509 2760259052 122
146 iso_pr_bacteria 2758568510 2760260873 122
147 iso_pr_bacteria 2758568511 2760262527 122
148 iso_pr_bacteria 2758568512 2760264280 122
149 iso_pr_bacteria 2758568513 2760266126 122
150 iso_pr_bacteria 2758568514 2760268134 122
151 iso_pr_bacteria 2758568515 2760269971 122
152 iso_pr_bacteria 2758568558 2760424209 122
153 iso_pr_bacteria 2785510748 2785747780 122
154 iso_pr_bacteria 2799112220 2799192062 122
155 iso_pr_bacteria 2799112229 2799230128 122
156 iso_pr_bacteria 2799112230 2799232107 122
157 iso_pr_bacteria 2808606957 2811756662 122
158 iso_pr_bacteria 2814123166 2815023100 122
159 iso_pr_bacteria 2818991478 2819787672 122
160 iso_pr_bacteria 2820261600 2820262908 122
161 iso_pr_bacteria 2820275298 2820275779 122
162 iso_pr_bacteria 2820296961 2820297059 122
163 iso_pr_bacteria 2820393573 2820396548 122
164 iso_pr_bacteria 2820424542 2820424585 122
165 iso_pr_bacteria 2820492969 2820493222 122
166 iso_pr_bacteria 2820520043 2820520417 122
167 iso_pr_bacteria 2820602899 2820603394 122
168 iso_pr_bacteria 2820613375 2820614216 122
169 iso_pr_bacteria 2820634724 2820636013 122
170 iso_pr_bacteria 2820639607 2820640270 122
171 iso_pr_bacteria 2820644600 2820646649 122
172 iso_pr_bacteria 2820799971 2820799995 122
173 iso_pr_bacteria 2820803007 2820805244 122
174 iso_pr_bacteria 2820825283 2820826981 122
175 iso_pr_bacteria 2820842553 2820844844 122
176 iso_pr_bacteria 2820863028 2820864689 122
177 iso_pr_bacteria 2820889385 2820890659 122
178 iso_pr_bacteria 2820926697 2820927929 122
179 iso_pr_bacteria 2820947865 2820948448 122
180 iso_pr_bacteria 2824199081 2824200270 122
181 iso_pr_bacteria 2837204985 2837205853 122
182 iso_pr_bacteria 2841168549 2841170049 122
183 iso_pr_bacteria 2848356102 2848359458 122
184 iso_pr_bacteria 2851410423 2851411794 122
185 iso_pr_bacteria 2852016966 2852018966 122
186 iso_pr_bacteria 2852431164 2852434103 122
187 iso_pr_bacteria 2862784999 2862787538 122
188 iso_pr_bacteria 2863397684 2863399684 122
189 iso_pr_bacteria 2865982043 2865983469 122
190 iso_pr_bacteria 2873196663 2873203579 122
191 iso_pr_bacteria 2873586004 2873586653 122
192 iso_pr_bacteria 2873589062 2873589302 122
193 iso_pr_bacteria 2873632256 2873632706 122
194 iso_pr_bacteria 2877513988 2877515444 122
195 iso_pr_bacteria 2879643867 2879644239 122
196 iso_pr_bacteria 2882334426 2882335417 122
197 iso_pr_bacteria 2883361506 2883362343 122
198 iso_pr_bacteria 2883683260 2883684078 122
199 iso_pr_bacteria 2884351759 2884355128 122
200 iso_pr_bacteria 2884613238 2884615775 122
201 iso_pr_bacteria 2896402965 2896403539 122
202 iso_pr_bacteria 2896955351 2896957738 122
203 iso_pr_bacteria 2908241010 2908245379 122
204 iso_pr_bacteria 2909412500 2909412869 122
205 iso_pr_bacteria 2909881144 2909881931 122
206 iso_pr_bacteria 2910090113 2910091665 122
207 iso_pr_bacteria 2912324399 2912325638 122
208 iso_pr_bacteria 2912749649 2912750161 122
209 iso_pr_bacteria 2912817845 2912825156 122
210 iso_pr_bacteria 2918394494 2918395956 122
211 iso_pr_bacteria 2931425734 2931429064 122
212 iso_pr_bacteria 2958885890 2958887124 122
213 iso_pr_bacteria 2961465228 2961466581 122
214 iso_pr_bacteria 2961515617 2961516945 122
215 iso_pr_bacteria 2968368220 2968369789 122
216 iso_pr_bacteria 2971062614 2971063699 122
217 iso_pr_bacteria 2979949929 2979951278 122
218 iso_pr_bacteria 3004719924 3004721809 122
219 iso_pr_bacteria 3006461590 3006462659 122
220 iso_pr_bacteria 3006468911 3006474018 122
221 iso_pr_bacteria 3006667155 3006670025 122
222 iso_pr_bacteria 647000328 647324285 122
223 iso_pr_bacteria 8004832522 8004833747 122
224 iso_pr_bacteria 8012935351 8012938335 122
225 iso_pr_bacteria 8017440191 8017440806 122
226 iso_pr_bacteria 8017458139 8017458396 122
227 iso_pr_bacteria 8017462664 8017464217 122
228 iso_pr_bacteria 8017536074 8017537610 122
229 iso_pr_bacteria 8024981139 8024982571 122
230 iso_pr_bacteria 8024982947 8024984225 122
231 iso_pr_bacteria 8024984606 8024985983 122
232 iso_pr_bacteria 8024986378 8024987801 122
233 iso_pr_bacteria 8046957834 8046958455 122
234 iso_pr_bacteria 8053361298 8053362090 122
235 iso_pr_bacteria 8062637095 8062639502 122
236 iso_pr_bacteria 8067987626 8067989744 122
237 iso_pr_bacteria 8069511479 8069515182 122
238 iso_pr_bacteria 8077783556 8077785836 122
239 iso_pr_bacteria 8110340172 8110340540 122
240 iso_pr_bacteria 8110341875 8110342616 122
241 3300000062 IMNBL1DRAFT_c0000426 IMNBL1DRAFT_000042640 123
242 3300000062 IMNBL1DRAFT_c0024154 IMNBL1DRAFT_00241546 123
243 3300000062 IMNBL1DRAFT_c0025280 IMNBL1DRAFT_00252804 123
244 3300000089 AustNasuHG_c1001775 AustNasuHG_100177511 123
245 3300000333 HBC_ctgsDRAFT_1113527 HBC_ctgsDRAFT_11135273 123
246 3300002450 JGI24695J34938_10061783 JGI24695J34938_100617833 123
247 3300002462 JGI24702J35022_10003607 JGI24702J35022_1000360710 123
248 3300002462 JGI24702J35022_10012448 JGI24702J35022_100124484 123
249 3300002462 JGI24702J35022_10168039 JGI24702J35022_101680393 123
250 3300002462 JGI24702J35022_10308613 JGI24702J35022_103086133 123
251 3300002462 JGI24702J35022_10411313 JGI24702J35022_104113132 123
252 3300002501 JGI24703J35330_11739032 JGI24703J35330_117390323 123
253 3300002504 JGI24705J35276_12219518 JGI24705J35276_122195185 123
254 3300002507 JGI24697J35500_11090288 JGI24697J35500_110902882 123
255 3300002507 JGI24697J35500_11270675 JGI24697J35500_112706753 123
256 3300002508 JGI24700J35501_10924065 JGI24700J35501_109240658 123
257 3300002834 JGI24696J40584_12640608 JGI24696J40584_126406082 123
258 3300002834 JGI24696J40584_12931166 JGI24696J40584_129311663 123
259 3300005071 Ga0068302_10000197 Ga0068302_1000019717 123
260 3300005083 Ga0068305_10005402 Ga0068305_1000540216 123
261 3300005200 Ga0072940_1088022 Ga0072940_10880222 123
262 3300005200 Ga0072940_1088023 Ga0072940_10880235 123
263 3300005200 Ga0072940_1097075 Ga0072940_10970752 123
264 3300005200 Ga0072940_1294333 Ga0072940_12943332 123
265 3300005200 Ga0072940_1324024 Ga0072940_13240244 123
266 3300005201 Ga0072941_1007162 Ga0072941_100716215 123
267 3300005201 Ga0072941_1012258 Ga0072941_101225819 123
268 3300005201 Ga0072941_1096920 Ga0072941_10969205 123
269 3300005485 Ga0074263_101665 Ga0074263_1016654 123
270 3300007901 Ga0111035_103226 Ga0111035_1032263 123
271 3300009784 Ga0123357_10748372 Ga0123357_107483722 123
272 3300009826 Ga0123355_10000553 Ga0123355_1000055338 123
273 3300009826 Ga0123355_10004431 Ga0123355_1000443115 123
274 3300009826 Ga0123355_10197417 Ga0123355_101974173 123
275 3300009826 Ga0123355_10382865 Ga0123355_103828653 123
276 3300009826 Ga0123355_10458983 Ga0123355_104589833 123
277 3300009826 Ga0123355_10526999 Ga0123355_105269995 123
278 3300009826 Ga0123355_10529157 Ga0123355_105291574 123
279 3300009826 Ga0123355_10622984 Ga0123355_106229842 123
280 3300009826 Ga0123355_10647649 Ga0123355_106476493 123
281 3300009826 Ga0123355_11077843 Ga0123355_110778432 123
282 3300010049 Ga0123356_10036140 Ga0123356_100361405 123
283 3300010049 Ga0123356_10076917 Ga0123356_100769172 123
284 3300010049 Ga0123356_12338992 Ga0123356_123389922 123
285 3300010049 Ga0123356_13483874 Ga0123356_134838741 123
286 3300010167 Ga0123353_10000033 Ga0123353_1000003345 123
287 3300010167 Ga0123353_10000701 Ga0123353_1000070112 123
288 3300010167 Ga0123353_10008423 Ga0123353_1000842317 123
289 3300010167 Ga0123353_10075100 Ga0123353_1007510011 123
290 3300010167 Ga0123353_10753410 Ga0123353_107534102 123
291 3300010167 Ga0123353_10755298 Ga0123353_107552982 123
292 3300010167 Ga0123353_10951934 Ga0123353_109519341 123
293 3300010167 Ga0123353_10974117 Ga0123353_109741172 123
294 3300010167 Ga0123353_11046961 Ga0123353_110469611 123
295 3300010167 Ga0123353_11096448 Ga0123353_110964484 123
296 3300010167 Ga0123353_11187036 Ga0123353_111870361 123
297 3300010167 Ga0123353_11665883 Ga0123353_116658832 123
298 3300010167 Ga0123353_11684442 Ga0123353_116844421 123
299 3300010167 Ga0123353_12017310 Ga0123353_120173101 123
300 3300010167 Ga0123353_12192902 Ga0123353_121929022 123
301 3300010167 Ga0123353_12868983 Ga0123353_128689832 123
302 3300010882 Ga0123354_10943630 Ga0123354_109436301 123
303 3300010882 Ga0123354_11006874 Ga0123354_110068741 123
304 3300012806 Ga0160442_100131 Ga0160442_10013113 123
305 3300012809 Ga0160466_100074 Ga0160466_10007449 123
306 3300012814 Ga0160453_109690 Ga0160453_1096902 123
307 3300012815 Ga0160440_100031 Ga0160440_10003162 123
308 3300012815 Ga0160440_103450 Ga0160440_1034503 123
309 3300012818 Ga0160432_103527 Ga0160432_1035272 123
310 3300012824 Ga0160469_100487 Ga0160469_10048722 123
311 3300012832 Ga0160458_120408 Ga0160458_1204082 123
312 3300012835 Ga0160446_100672 Ga0160446_1006728 123
313 3300012846 Ga0160433_104418 Ga0160433_1044184 123
314 3300012852 Ga0160430_100932 Ga0160430_1009327 123
315 3300012854 Ga0160448_117245 Ga0160448_1172453 123
316 3300012858 Ga0160457_1002026 Ga0160457_10020261 123
317 3300012858 Ga0160457_1022964 Ga0160457_10229642 123
318 3300038395 Ga0415639_106168 Ga0415639_106168_111_482 123
319 3300042605 Ga0466716_077310 Ga0466716_077310_7839_8210 123
320 3300042605 Ga0466716_404377 Ga0466716_404377_914_1285 123
321 3300042620 Ga0466728_141395 Ga0466728_141395_12918_13289 123
322 3300042620 Ga0466728_240430 Ga0466728_240430_13644_14015 123
323 3300042625 Ga0466730_086863 Ga0466730_086863_3293_3664 123
324 3300060896 Ga0590775_17304 Ga0590775_17304_237_608 123
325 3300012820 Ga0160456_100878 Ga0160456_10087816 124
326 3300038395 Ga0415639_003328 Ga0415639_003328_2418_2819 133

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e 13 133 0.99

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.