Protein Family IF04209

Metagenome Isolate
193 Members
139 Samples
98 Scaffolds
339.15 Avg Length

🧬 Representative Sequence

ID
3300026558|Ga0255576_1000002|Ga0255576_100000245
Length
335 aa
Sequence
LERVQSAEFLAEDAAELSLRPEQLSQYIGQSKVKENMRVFIAAAKKRQEAIDHILLYGPPGLGKTTLANIIAHELGVNIKHTSGPALERSGDLAAILSALEPGDVLFIDEIHRLSRSIEEILYSAMEDYCLDIILGKEASARSMRIDLPPFTLIGATTRVGDLSAPLRDRFGVHAHLEYYTQADLYEIVKRTSAVFQIEIDEQAAKELASRSRGTPRIANRLFRRIRDFAQVLDDASFISLAMTQEALGRLDIDASGLDAVDHKILRGIAERFNGGPVGLEALAASIAEEAQTLEDVYEPFLLQEGFIVRTPRGRILSAKAYAHLGIAHQGTLEE

📊 Sample Types

Isolate 49.2%
Metagenome 50.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.0%
Apidae 16.1%
Termitidae 10.9%
Scarabaeidae 5.1%
Blattidae 4.4%
Formicidae 4.4%
Kalotermitidae 4.4%
Tenebrionidae 3.6%
Hydrophilidae 2.9%
Termopsidae 2.9%
Elmidae 2.2%
Passalidae 1.5%
Dytiscidae 1.5%
Drosophilidae 1.5%
Halictidae 0.7%
Nephropidae 0.7%
Hodotermitidae 0.7%
Rhaphidophoridae 0.7%
Euphausiidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 180
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
2 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
3 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
4 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
5 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
6 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
7 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
8 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
9 8064008355 Heyndrickxia oleronia Isolate Unclassified
10 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
11 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
12 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
13 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
14 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
15 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
16 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
17 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
18 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
21 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
22 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
26 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
29 2864895409 Bacillus aerius S00152 Isolate Elmidae
30 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
31 2916858470 Heyndrickxia oleronia Isolate Unclassified
32 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
33 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
34 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
35 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
36 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
37 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
40 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
41 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
42 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
43 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
44 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
45 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
46 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
47 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
48 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
49 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
50 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
53 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
54 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
55 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
56 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
57 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
58 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
59 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
60 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
61 3004719924 Lactobacillus sp. W8174 Isolate Apidae
62 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
63 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
64 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
65 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
66 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
67 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
68 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
69 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
70 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
71 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
72 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
73 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
74 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
75 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
76 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
77 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
78 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
79 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
80 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
83 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
84 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
85 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
86 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
87 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
88 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
89 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
90 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
91 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
92 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
93 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
94 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
95 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
96 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
97 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
98 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
99 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
100 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
101 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
102 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
103 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
104 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
105 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
106 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
107 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
108 2864801025 Bacillus aerius S00042 Isolate Elmidae
109 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
110 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
111 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
112 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
113 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
114 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
115 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
116 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
117 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
118 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
119 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
120 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
121 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
122 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
123 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
124 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
125 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
126 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
127 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
128 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
129 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
130 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
131 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
132 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
133 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
134 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
135 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
136 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
137 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
138 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
139 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0011 3300056790 Bacteria 1623141
2 Ga0466731_058250 3300042622 Bacteria 4499
3 Ga0466706_126729 3300042599 Bacteria 1915
4 Ga0466706_130883 3300042599 Unclassified 2108
5 Ga0466714_042010 3300042603 Bacteria 10641
6 Ga0466723_014071 3300042618 Bacteria 4439
7 IMNBL1DRAFT_c0006047 3300000062 Bacteria 6737
8 Ga0562376_0484 3300056857 Unclassified 72077
9 Ga0466704_153708 3300042643 Bacteria 1576
10 Ga0466701_095476 3300042598 Bacteria 1660
11 Ga0466700_247905 3300042600 Bacteria 54776
12 Ga0466723_058375 3300042618 Bacteria 5262
13 Ga0415639_048598 3300038395 Bacteria 11476
14 Ga0123355_10227580 3300009826 Bacteria 2669
15 Ga0123356_10013783 3300010049 Bacteria 7785
16 Ga0123356_10102417 3300010049 Bacteria 2749
17 Ga0123353_10229479 3300010167 Bacteria 2896
18 IMNBL1DRAFT_c0000210 3300000062 Bacteria 51304
19 JGI24702J35022_10161322 3300002462 Bacteria 1263
20 CVPL010L_1000254 3300002932 Unclassified 27217
21 Ga0072941_1035013 3300005201 Bacteria 36026
22 Ga0562379_0009 3300056790 Bacteria 1927879
23 Ga0562377_0413 3300056842 Unclassified 75935
24 Ga0562377_1546 3300056842 Bacteria 22819
25 Ga0562375_0018 3300056856 Bacteria 940838
26 Ga0562374_0725 3300057007 Bacteria 48750
27 Ga0466706_057203 3300042599 Bacteria 23442
28 Ga0466706_113114 3300042599 Bacteria 24078
29 Ga0466700_363567 3300042600 Bacteria 7780
30 Ga0466707_112060 3300042601 Bacteria 1390
31 Ga0466705_450754 3300042612 Bacteria 12241
32 Ga0466715_347547 3300042616 Bacteria 1853
33 Ga0255572_1000643 3300026175 Bacteria 42323
34 Ga0123355_10576906 3300009826 Bacteria 1347
35 JGI24700J35501_10930625 3300002508 Bacteria 16998
36 Ga0074278_134484 3300005721 Unclassified 8050
37 Ga0111035_105495 3300007901 Bacteria 9718
38 Ga0562377_0106 3300056842 Bacteria 268063
39 Ga0562377_0245 3300056842 Bacteria 125870
40 Ga0562374_0137 3300057007 Bacteria 181544
41 Ga0466706_039111 3300042599 Bacteria 2312
42 Ga0466707_387069 3300042601 Bacteria 86246
43 Ga0415639_014375 3300038395 Bacteria 22423
44 Ga0415639_028151 3300038395 Bacteria 9340
45 Ga0123355_10078103 3300009826 Bacteria 5289
46 Ga0074278_131062 3300005721 Unclassified 11319
47 Ga0466727_088990 3300042655 Bacteria 31813
48 Ga0466706_115939 3300042599 Bacteria 29469
49 Ga0466707_091977 3300042601 Bacteria 1605
50 Ga0466707_126663 3300042601 Bacteria 75061
51 Ga0466714_004005 3300042603 Bacteria 23670
52 Ga0123356_10124854 3300010049 Unclassified 2511
53 Ga0123353_10288607 3300010167 Bacteria 2513
54 Ga0123353_10539665 3300010167 Bacteria 1686
55 2227535748 2225789004 Bacteria 16072
56 HBC_ctgsDRAFT_1002228 3300000333 Bacteria 4397
57 Ga0102734_1000142 3300007129 Bacteria 38625
58 Ga0466733_033054 3300042659 Bacteria 15005
59 Ga0562376_0359 3300056857 Unclassified 87384
60 Ga0466704_419901 3300042643 Bacteria 4506
61 Ga0466704_489848 3300042643 Unclassified 8728
62 Ga0466705_414914 3300042612 Bacteria 16359
63 Ga0255576_1000002 3300026558 Bacteria 294856
64 Ga0466656_190495 3300042550 Bacteria 1388
65 Ga0466696_226682 3300042596 Bacteria 7480
66 Ga0123355_10388949 3300009826 Bacteria 1810
67 Ga0123353_10303439 3300010167 Bacteria 2435
68 JGI24703J35330_11748860 3300002501 Bacteria 57330
69 Ga0562375_0843 3300056856 Bacteria 51409
70 Ga0466735_007727 3300042624 Bacteria 126549
71 Ga0466708_266378 3300042652 Bacteria 17902
72 Ga0466706_039709 3300042599 Bacteria 84247
73 Ga0466706_073321 3300042599 Bacteria 40773
74 Ga0466713_153008 3300042602 Bacteria 19558
75 Ga0466714_002885 3300042603 Bacteria 1876
76 Ga0466726_118401 3300042619 Bacteria 32484
77 Ga0123356_10250715 3300010049 Bacteria 1848
78 2211830525 2209111004 Bacteria 29340
79 2227247455 2225789004 Unclassified 31967
80 HBC_ctgsDRAFT_1000963 3300000333 Bacteria 6260
81 JGI24703J35330_11748625 3300002501 Bacteria 22557
82 JGI24703J35330_11748859 3300002501 Bacteria 57247
83 Ga0068302_10011471 3300005071 Unclassified 15182
84 Ga0466705_357705 3300042612 Bacteria 8644
85 Ga0562377_0008 3300056842 Bacteria 1610398
86 Ga0562375_0525 3300056856 Bacteria 77345
87 Ga0466724_28917 3300042649 Bacteria 19936
88 Ga0466727_292510 3300042655 Bacteria 20952
89 Ga0466706_031560 3300042599 Unclassified 1623
90 Ga0466706_262106 3300042599 Bacteria 3234
91 Ga0466707_156642 3300042601 Bacteria 83711
92 Ga0466714_001938 3300042603 Bacteria 27309
93 Ga0255572_1000075 3300026175 Bacteria 79685
94 Ga0255575_1000001 3300026559 Bacteria 210766
95 Ga0415639_006031 3300038395 Bacteria 24237
96 Ga0415639_063843 3300038395 Bacteria 9362
97 Ga0123353_10006090 3300010167 Unclassified 15994
98 Ga0123353_10039832 3300010167 Bacteria 7404

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000062 IMNBL1DRAFT_c0000210 IMNBL1DRAFT_000021045 321
2 3300042612 Ga0466705_414914 Ga0466705_414914_9117_10100 321
3 3300042601 Ga0466707_112060 Ga0466707_112060_86_1054 322
4 3300056842 Ga0562377_0008 Ga0562377_0008_421853_422863 324
5 3300042643 Ga0466704_419901 Ga0466704_419901_1046_2026 326
6 3300042601 Ga0466707_156642 Ga0466707_156642_73640_74626 328
7 3300056842 Ga0562377_0413 Ga0562377_0413_3684_4670 328
8 3300056857 Ga0562376_0359 Ga0562376_0359_54134_55120 328
9 3300056857 Ga0562376_0484 Ga0562376_0484_58289_59275 328
10 3300057007 Ga0562374_0137 Ga0562374_0137_156412_157398 328
11 iso_pr_bacteria 2731957677 2732687903 328
12 2225789004 2227535748 2228053123 330
13 3300026175 Ga0255572_1000643 Ga0255572_10006433 331
14 3300042618 Ga0466723_058375 Ga0466723_058375_147_1142 331
15 iso_pr_bacteria 2820393573 2820394536 331
16 iso_pr_bacteria 2834951433 2834953253 331
17 3300002501 JGI24703J35330_11748625 JGI24703J35330_1174862522 332
18 3300010049 Ga0123356_10124854 Ga0123356_101248541 332
19 3300026175 Ga0255572_1000075 Ga0255572_10000759 332
20 3300026559 Ga0255575_1000001 Ga0255575_100000114 332
21 3300042599 Ga0466706_039709 Ga0466706_039709_260_1258 332
22 3300042600 Ga0466700_247905 Ga0466700_247905_17229_18227 332
23 3300042655 Ga0466727_292510 Ga0466727_292510_5231_6229 332
24 3300056856 Ga0562375_0525 Ga0562375_0525_35498_36496 332
25 iso_pr_bacteria 2997944163 2997944230 332
26 iso_pr_bacteria 647533136 647746885 332
27 iso_pr_bacteria 8002519755 8002521359 332
28 2225789004 2227247455 2227689166 333
29 3300002501 JGI24703J35330_11748859 JGI24703J35330_1174885918 333
30 3300007901 Ga0111035_105495 Ga0111035_1054955 333
31 3300042599 Ga0466706_130883 Ga0466706_130883_225_1226 333
32 3300042655 Ga0466727_088990 Ga0466727_088990_2910_3911 333
33 3300042659 Ga0466733_033054 Ga0466733_033054_13555_14556 333
34 3300056842 Ga0562377_0245 Ga0562377_0245_19886_20887 333
35 3300056842 Ga0562377_1546 Ga0562377_1546_12093_13094 333
36 iso_pr_bacteria 2820236043 2820238207 333
37 iso_pr_bacteria 2820301196 2820301672 333
38 iso_pr_bacteria 2822232166 2822232610 333
39 iso_pr_bacteria 2822450720 2822455587 333
40 iso_pr_bacteria 2850695442 2850697429 333
41 iso_pr_bacteria 2864981449 2864984575 333
42 iso_pr_bacteria 2878857142 2878857248 333
43 iso_pr_bacteria 2916858470 2916863976 333
44 iso_pr_bacteria 8064008355 8064010211 333
45 2209111004 2211830525 2211865450 334
46 3300002501 JGI24703J35330_11748860 JGI24703J35330_117488607 334
47 3300002508 JGI24700J35501_10930625 JGI24700J35501_1093062514 334
48 3300002932 CVPL010L_1000254 CVPL010L_10002545 334
49 3300042599 Ga0466706_126729 Ga0466706_126729_299_1303 334
50 3300042649 Ga0466724_28917 Ga0466724_28917_10492_11496 334
51 iso_pr_bacteria 2524614537 2524835297 334
52 iso_pr_bacteria 2808606958 2811757629 334
53 iso_pr_bacteria 2864801025 2864803413 334
54 iso_pr_bacteria 2864895409 2864897795 334
55 iso_pr_bacteria 2940218408 2940219017 334
56 iso_pr_bacteria 2940261461 2940262211 334
57 iso_pr_bacteria 8043041867 8043042185 334
58 3300005201 Ga0072941_1035013 Ga0072941_103501322 335
59 3300007129 Ga0102734_1000142 Ga0102734_10001423 335
60 3300026558 Ga0255576_1000002 Ga0255576_100000245 335
61 3300042602 Ga0466713_153008 Ga0466713_153008_15314_16321 335
62 iso_pr_bacteria 2873584433 2873584781 335
63 iso_pr_bacteria 2936628749 2936630192 335
64 3300042599 Ga0466706_031560 Ga0466706_031560_235_1245 336
65 3300042599 Ga0466706_073321 Ga0466706_073321_21322_22332 336
66 3300042599 Ga0466706_113114 Ga0466706_113114_8481_9491 336
67 3300042599 Ga0466706_262106 Ga0466706_262106_1220_2230 336
68 3300042652 Ga0466708_266378 Ga0466708_266378_3094_4104 336
69 3300056842 Ga0562377_0106 Ga0562377_0106_33496_34506 336
70 3300056856 Ga0562375_0018 Ga0562375_0018_160981_161991 336
71 3300057007 Ga0562374_0725 Ga0562374_0725_3285_4295 336
72 iso_pr_bacteria 2558860143 2559001001 336
73 iso_pr_bacteria 2675903377 2677724061 336
74 iso_pr_bacteria 2785510748 2785747647 336
75 iso_pr_bacteria 2799112220 2799191928 336
76 iso_pr_bacteria 2799112229 2799230245 336
77 iso_pr_bacteria 2799112230 2799231971 336
78 iso_pr_bacteria 2873581347 2873582131 336
79 iso_pr_bacteria 2873632256 2873633177 336
80 iso_pr_bacteria 2877522083 2877522986 336
81 iso_pr_bacteria 2882334426 2882335537 336
82 iso_pr_bacteria 2905310146 2905311744 336
83 iso_pr_bacteria 2940236825 2940238553 336
84 iso_pr_bacteria 2940339133 2940340921 336
85 iso_pr_bacteria 2940341480 2940343223 336
86 iso_pr_bacteria 2940343849 2940345590 336
87 iso_pr_bacteria 8002304686 8002305580 336
88 iso_pr_bacteria 8007220153 8007221121 336
89 iso_pr_bacteria 8017458139 8017460597 336
90 3300042599 Ga0466706_057203 Ga0466706_057203_7042_8055 337
91 3300056790 Ga0562379_0009 Ga0562379_0009_997088_998101 337
92 3300056790 Ga0562379_0011 Ga0562379_0011_202235_203248 337
93 3300056856 Ga0562375_0843 Ga0562375_0843_47764_48777 337
94 iso_pr_bacteria 2645727721 2646684704 337
95 iso_pr_bacteria 2684622911 2686074058 337
96 iso_pr_bacteria 2684622914 2686079497 337
97 iso_pr_bacteria 2758568501 2760245667 337
98 iso_pr_bacteria 2758568502 2760247298 337
99 iso_pr_bacteria 2758568503 2760248960 337
100 iso_pr_bacteria 2758568504 2760250622 337
101 iso_pr_bacteria 2758568510 2760260761 337
102 iso_pr_bacteria 2758568512 2760264170 337
103 iso_pr_bacteria 2758568514 2760268013 337
104 iso_pr_bacteria 2758568558 2760424091 337
105 iso_pr_bacteria 2851410423 2851411683 337
106 iso_pr_bacteria 2873595552 2873597044 337
107 iso_pr_bacteria 2877513988 2877515327 337
108 iso_pr_bacteria 2881902429 2881903510 337
109 iso_pr_bacteria 2961465228 2961466471 337
110 iso_pr_bacteria 2968368220 2968369679 337
111 iso_pr_bacteria 2971062614 2971063651 337
112 iso_pr_bacteria 3004719924 3004721691 337
113 iso_pr_bacteria 8007211731 8007212784 337
114 iso_pr_bacteria 8007215774 8007220073 337
115 iso_pr_bacteria 8017440191 8017440689 337
116 iso_pr_bacteria 8017536074 8017537487 337
117 iso_pr_bacteria 8114544644 8114547035 337
118 3300005721 Ga0074278_134484 Ga0074278_1344848 338
119 3300010167 Ga0123353_10288607 Ga0123353_102886072 338
120 3300042619 Ga0466726_118401 Ga0466726_118401_19318_20334 338
121 iso_pr_bacteria 2684622912 2686075771 338
122 iso_pr_bacteria 2758568511 2760262410 338
123 iso_pr_bacteria 2758568557 2760422060 338
124 iso_pr_bacteria 2758568559 2760425943 338
125 iso_pr_bacteria 2758568560 2760427875 338
126 iso_pr_bacteria 2758568561 2760428968 338
127 iso_pr_bacteria 2814123166 2815022796 338
128 iso_pr_bacteria 2912324399 2912325520 338
129 iso_pr_bacteria 2979949929 2979951161 338
130 iso_pr_bacteria 8001918023 8001918303 338
131 3300005071 Ga0068302_10011471 Ga0068302_100114715 339
132 3300042612 Ga0466705_450754 Ga0466705_450754_130_1149 339
133 iso_pr_bacteria 2873600114 2873601595 339
134 iso_pr_bacteria 2873610414 2873611958 339
135 iso_pr_bacteria 2896402965 2896404493 339
136 3300009826 Ga0123355_10078103 Ga0123355_100781034 340
137 3300010049 Ga0123356_10013783 Ga0123356_100137836 340
138 3300010167 Ga0123353_10539665 Ga0123353_105396652 340
139 3300042598 Ga0466701_095476 Ga0466701_095476_275_1297 340
140 3300042622 Ga0466731_058250 Ga0466731_058250_1643_2665 340
141 iso_pr_bacteria 2820053807 2820054707 340
142 iso_pr_bacteria 2820134530 2820134620 340
143 3300000333 HBC_ctgsDRAFT_1000963 HBC_ctgsDRAFT_10009634 341
144 3300000333 HBC_ctgsDRAFT_1002228 HBC_ctgsDRAFT_10022283 341
145 3300010049 Ga0123356_10102417 Ga0123356_101024173 341
146 3300038395 Ga0415639_063843 Ga0415639_063843_3246_4307 341
147 3300042599 Ga0466706_039111 Ga0466706_039111_366_1391 341
148 3300042601 Ga0466707_387069 Ga0466707_387069_17681_18706 341
149 3300042601 Ga0466707_091977 Ga0466707_091977_120_1148 342
150 iso_pr_bacteria 2820418027 2820420058 343
151 3300010167 Ga0123353_10006090 Ga0123353_1000609010 344
152 3300042550 Ga0466656_190495 Ga0466656_190495_183_1217 344
153 iso_pr_bacteria 2820533259 2820533793 344
154 3300010167 Ga0123353_10303439 Ga0123353_103034393 345
155 3300042599 Ga0466706_115939 Ga0466706_115939_28057_29094 345
156 3300042601 Ga0466707_126663 Ga0466707_126663_71216_72253 345
157 3300009826 Ga0123355_10576906 Ga0123355_105769061 346
158 iso_pr_bacteria 2820512088 2820512685 346
159 iso_pr_bacteria 2820516196 2820516905 346
160 3300009826 Ga0123355_10388949 Ga0123355_103889493 348
161 iso_pr_bacteria 2684622913 2686077654 348
162 iso_pr_bacteria 2758568513 2760266008 348
163 iso_pr_bacteria 2758568515 2760269851 348
164 iso_pr_bacteria 2961515617 2961516826 348
165 iso_pr_bacteria 8017462664 8017464094 348
166 3300005721 Ga0074278_131062 Ga0074278_1310626 349
167 3300009826 Ga0123355_10227580 Ga0123355_102275803 350
168 3300002462 JGI24702J35022_10161322 JGI24702J35022_101613221 351
169 3300042600 Ga0466700_363567 Ga0466700_363567_6712_7767 351
170 3300042616 Ga0466715_347547 Ga0466715_347547_31_1089 352
171 3300042618 Ga0466723_014071 Ga0466723_014071_917_1975 352
172 3300042624 Ga0466735_007727 Ga0466735_007727_62785_63843 352
173 iso_pr_bacteria 2820447167 2820448076 352
174 3300010167 Ga0123353_10039832 Ga0123353_100398325 353
175 3300038395 Ga0415639_028151 Ga0415639_028151_5602_6663 353
176 3300042603 Ga0466714_001938 Ga0466714_001938_17607_18668 353
177 3300042603 Ga0466714_042010 Ga0466714_042010_1045_2106 353
178 3300038395 Ga0415639_006031 Ga0415639_006031_16425_17489 354
179 iso_pr_bacteria 2820342392 2820343380 354
180 3300010049 Ga0123356_10250715 Ga0123356_102507153 355
181 3300038395 Ga0415639_014375 Ga0415639_014375_7472_8539 355
182 3300038395 Ga0415639_048598 Ga0415639_048598_10056_11123 355
183 iso_pr_bacteria 2820261600 2820263051 356
184 iso_pr_bacteria 2820275298 2820277096 357
185 3300042603 Ga0466714_004005 Ga0466714_004005_9687_10763 358
186 3300042596 Ga0466696_226682 Ga0466696_226682_4886_5968 360
187 3300042603 Ga0466714_002885 Ga0466714_002885_449_1531 360
188 3300042643 Ga0466704_153708 Ga0466704_153708_238_1320 360
189 3300042643 Ga0466704_489848 Ga0466704_489848_3090_4172 360
190 3300042612 Ga0466705_357705 Ga0466705_357705_3300_4385 361
191 3300010167 Ga0123353_10229479 Ga0123353_102294792 362
192 iso_pr_bacteria 2820272499 2820274060 364
193 3300000062 IMNBL1DRAFT_c0006047 IMNBL1DRAFT_00060472 397

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 19 177 0.99
PF05491 RuvB_C RuvB C-terminal winged helix domain 256 325 0.98
PF17864 AAA_lid_4 RuvB AAA lid domain 180 254 0.96
PF00004 AAA ATPase family associated with various cellular activities (AAA) 54 178 0.94
PF06068 TIP49 TIP49 P-loop domain 26 82 0.9
PF07728 AAA_5 AAA domain (dynein-related subfamily) 53 171 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF06068 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.