Protein Family IF04196

Metagenome Isolate
139 Members
99 Samples
73 Scaffolds
418.93 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_156421|Ga0264413_1564212
Length
482 aa
Sequence
MYKPQLRDIQKARQRINSVVVHTPLSKNVALSEQYGATVLLKREDLQAVRSYKIRGAYNKIASLTKAQLANGVVCASAGNHAQGVAFACSALNIRGTIFMPTPTPNQKVKQVKMFGKDCIEIVSVGDTFDDAFAEAVKFCDEHKSTFIHPFNDERVIEGQATLGLDILNDTDQPVDYLFIPIGGGGLAAGVGSVFKNISPETKIIGVEPVGAASMKAAIEAKQIVTLPEIDTFADGVAVRRAGELTFEICREVLDDIVLVPEGKICSTILQLYNESAIVVEPAGGISISALDFYKKQIKGKTVVCIVSGSNNDITRMEEIKERSLLYEGLKHYFVIRFPQRAGALREFLEFVLGPNDDITHFEYKKKHFREKGPAVIGVELKQKEDFDGLINRMKERKIGYEYINKQEDLFQFLXMLSKAKHLIIFFAPLRMTKRNSCVLPTTLQPPLHAPHERPQPLPFGFVVEVAELLEQGLYKGVVNYG

📊 Sample Types

Isolate 47.5%
Metagenome 52.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 11.8%
Kalotermitidae 11.8%
Termitidae 8.6%
Blattellidae 7.5%
Pyralidae 6.5%
Blaberidae 6.5%
Elmidae 5.4%
Corydiidae 3.2%
Culicidae 3.2%
Termopsidae 3.2%
Scarabaeidae 3.2%
Pseudophyllodromiidae 2.2%
Armadillidiidae 2.2%
Ectobiidae 2.2%
Nyctiboridae 2.2%
Bombycidae 2.2%
Drosophilidae 2.2%
Hodotermitidae 1.1%
Hydrophilidae 1.1%
Ocypodidae 1.1%
Apidae 1.1%
Formicidae 1.1%
Curculionidae 1.1%
Nephropidae 1.1%
Lamproblattidae 1.1%
Euphausiidae 1.1%
Portunidae 1.1%
Daphniidae 1.1%
Rhinotermitidae 1.1%
Blattidae 1.1%
Noctuidae 1.1%
Eresidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
2 2882250448 Bizionia sp. APA-3 Isolate
3 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
4 3002024525 Blattabacterium cuenoti EPILAmay Isolate Blaberidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3002003370 Blattabacterium cuenoti THEREAreg Isolate Corydiidae
13 3002007112 Blattabacterium cuenoti CYRTOsp Isolate Blaberidae
14 3002008367 Blattabacterium cuenoti PARANAUcir Isolate Blaberidae
15 3002028747 Blattabacterium cuenoti ESCALves Isolate Blattellidae
16 3002030550 Blattabacterium cuenoti NEOLAXmac Isolate Blaberidae
17 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
20 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
21 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
22 2518645548 Blattabacterium sp. (Blaberus giganteus) Isolate Blaberidae
23 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
24 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
25 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
26 2978778678 Bacillus cereus 25 Isolate Ocypodidae
27 3002002726 Blattabacterium cuenoti PARATEMsp Isolate Blattellidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
30 650716011 Blattabacterium sp. Bge Isolate Blattellidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
33 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
34 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
35 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
36 3002008998 Blattabacterium cuenoti PARCOBvir Isolate Blattellidae
37 3002025161 Blattabacterium cuenoti MEDIASdel Isolate Pseudophyllodromiidae
38 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
39 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
40 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 2537562000 Bacillus cereus HD73 Isolate Pyralidae
44 2561511170 Blattabacterium sp. (Blatta orientalis) Tarazona Isolate Unclassified
45 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
46 3002005847 Blattabacterium cuenoti ECTOBIsp Isolate Ectobiidae
47 3002007740 Blattabacterium cuenoti NYCTIBsp Isolate Nyctiboridae
48 3002023891 Blattabacterium cuenoti MEGALOsp Isolate Nyctiboridae
49 3002028123 Blattabacterium cuenoti LAMPROsp Isolate Lamproblattidae
50 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
51 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
54 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
59 2864836148 Arcicella rosea S00070 Isolate Elmidae
60 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
61 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
62 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
63 2969145278 Bacillus cereus 29 Isolate Portunidae
64 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
65 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
66 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
67 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
68 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
69 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
70 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
71 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
72 8064008355 Heyndrickxia oleronia Isolate Unclassified
73 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
74 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
75 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
76 3001995318 Blattabacterium cuenoti DYAKIkur Isolate Blattellidae
77 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
78 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
79 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
80 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
81 646311912 Blattabacterium sp. BPLAN Isolate Blattidae
82 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
83 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
84 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
85 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
86 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
87 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
88 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
89 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
90 2916858470 Heyndrickxia oleronia Isolate Unclassified
91 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
92 3002002099 Blattabacterium cuenoti ECTONUhan Isolate Ectobiidae
93 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
94 3002006476 Blattabacterium cuenoti GYNAcap Isolate Blaberidae
95 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
96 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
97 8022725327 Bacillus sp. SN10 Isolate Eresidae
98 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
99 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_307804 3300042612 Bacteria 2829
2 Ga0466733_007244 3300042659 Bacteria 4131
3 Ga0466733_206607 3300042659 Bacteria 13335
4 Ga0466708_186550 3300042652 Bacteria 6241
5 Ga0466706_106107 3300042599 Bacteria 4716
6 Ga0466714_032968 3300042603 Bacteria 3370
7 Ga0466714_048716 3300042603 Bacteria 6202
8 Ga0466716_323148 3300042605 Bacteria 2386
9 Ga0466705_074507 3300042612 Bacteria 30931
10 Ga0123353_10000019 3300010167 Bacteria 185006
11 Ga0160466_100434 3300012809 Bacteria 22125
12 Ga0466723_046219 3300042618 Bacteria 8851
13 Ga0466723_154051 3300042618 Bacteria 17284
14 Ga0160460_100222 3300012845 Bacteria 53540
15 Ga0063521_1000197 3300003973 Bacteria 43849
16 Ga0466704_115633 3300042643 Bacteria 47708
17 Ga0466706_106112 3300042599 Bacteria 35315
18 Ga0466706_237121 3300042599 Bacteria 3124
19 Ga0466714_060488 3300042603 Bacteria 2168
20 Ga0466711_107677 3300042615 Bacteria 13086
21 Ga0466715_185011 3300042616 Bacteria 9787
22 Ga0160468_100214 3300012819 Bacteria 36390
23 Ga0466690_240054 3300042590 Bacteria 6790
24 Ga0466691_149175 3300042593 Unclassified 11916
25 Ga0466696_150657 3300042596 Bacteria 11610
26 Ga0466708_241974 3300042652 Bacteria 10284
27 Ga0466708_253658 3300042652 Bacteria 15467
28 Ga0466708_359907 3300042652 Unclassified 21375
29 Ga0466706_112267 3300042599 Bacteria 15365
30 Ga0160465_100039 3300012803 Bacteria 172888
31 Ga0466715_488221 3300042616 Bacteria 3788
32 Ga0160445_100158 3300012847 Bacteria 59709
33 Ga0466735_215070 3300042624 Bacteria 1911
34 Ga0466706_104029 3300042599 Bacteria 9569
35 Ga0466705_266468 3300042612 Bacteria 9836
36 Ga0466733_095851 3300042659 Bacteria 1509
37 Ga0466726_039461 3300042619 Unclassified 3848
38 Ga0466728_122697 3300042620 Bacteria 5652
39 Ga0466729_135999 3300042621 Bacteria 5721
40 Ga0264413_156421 3300024493 Bacteria 2518
41 Ga0466690_060287 3300042590 Unclassified 2591
42 JGI24698J34947_10053530 3300002449 Unclassified 2019
43 Ga0466730_013558 3300042625 Unclassified 10146
44 Ga0466704_463112 3300042643 Unclassified 7515
45 Ga0466714_029688 3300042603 Bacteria 2979
46 Ga0466714_069410 3300042603 Bacteria 2864
47 Ga0466714_073459 3300042603 Bacteria 8545
48 Ga0466733_073991 3300042659 Bacteria 10194
49 Ga0466733_209294 3300042659 Bacteria 1934
50 Ga0466711_062624 3300042615 Bacteria 2888
51 Ga0466726_310015 3300042619 Bacteria 2354
52 Ga0466726_321113 3300042619 Archaea 1995
53 Ga0466690_034180 3300042590 Bacteria 2272
54 Ga0466691_041949 3300042593 Bacteria 15098
55 Ga0466691_103024 3300042593 Bacteria 23984
56 Ga0466706_022785 3300042599 Unclassified 5635
57 Ga0466700_224425 3300042600 Bacteria 2655
58 Ga0466714_031203 3300042603 Bacteria 6103
59 Ga0466714_155404 3300042603 Bacteria 9397
60 Ga0466733_138126 3300042659 Bacteria 81124
61 Ga0123353_10098483 3300010167 Bacteria 4712
62 Ga0072940_1038413 3300005200 Bacteria 1752
63 Ga0466706_260176 3300042599 Bacteria 28782
64 Ga0466714_105065 3300042603 Bacteria 2795
65 Ga0466733_211526 3300042659 Bacteria 6198
66 Ga0160471_100015 3300012812 Bacteria 404461
67 Ga0466712_139757 3300042614 Bacteria 6599
68 Ga0466723_168444 3300042618 Bacteria 8312
69 Ga0466691_054564 3300042593 Bacteria 7255
70 Ga0104048_1001767 3300007143 Bacteria 5546
71 Ga0466704_108271 3300042643 Bacteria 42780
72 Ga0466727_092227 3300042655 Bacteria 17505
73 Ga0466706_168401 3300042599 Bacteria 37088

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042625 Ga0466730_013558 Ga0466730_013558_21_1259 395
2 3300042659 Ga0466733_209294 Ga0466733_209294_259_1509 396
3 3300042643 Ga0466704_108271 Ga0466704_108271_29555_30802 397
4 3300042659 Ga0466733_007244 Ga0466733_007244_797_2047 397
5 3300042618 Ga0466723_168444 Ga0466723_168444_6752_8011 398
6 3300042643 Ga0466704_115633 Ga0466704_115633_45842_47101 399
7 3300042590 Ga0466690_240054 Ga0466690_240054_518_1777 400
8 3300042593 Ga0466691_054564 Ga0466691_054564_5325_6584 400
9 3300042600 Ga0466700_224425 Ga0466700_224425_837_2039 400
10 3300042603 Ga0466714_029688 Ga0466714_029688_488_1771 407
11 3300042603 Ga0466714_069410 Ga0466714_069410_1020_2303 407
12 3300012819 Ga0160468_100214 Ga0160468_10021425 411
13 iso_pr_bacteria 2811995047 2812947786 414
14 iso_pr_bacteria 2864878056 2864882621 414
15 iso_pr_bacteria 2864886855 2864891469 414
16 iso_pr_bacteria 2882250448 2882251651 414
17 3300007143 Ga0104048_1001767 Ga0104048_10017675 415
18 3300042590 Ga0466690_060287 Ga0466690_060287_292_1539 415
19 3300042593 Ga0466691_103024 Ga0466691_103024_10630_11877 415
20 3300042596 Ga0466696_150657 Ga0466696_150657_9759_11006 415
21 3300042603 Ga0466714_155404 Ga0466714_155404_2158_3405 415
22 3300042605 Ga0466716_323148 Ga0466716_323148_1094_2341 415
23 3300042614 Ga0466712_139757 Ga0466712_139757_2367_3614 415
24 3300042618 Ga0466723_046219 Ga0466723_046219_2647_3894 415
25 3300042619 Ga0466726_310015 Ga0466726_310015_634_1881 415
26 3300042621 Ga0466729_135999 Ga0466729_135999_769_2016 415
27 3300042652 Ga0466708_241974 Ga0466708_241974_3297_4544 415
28 iso_pr_bacteria 2718218155 2720328328 415
29 iso_pr_bacteria 2731957677 2732689528 415
30 3300002449 JGI24698J34947_10053530 JGI24698J34947_100535302 416
31 3300005200 Ga0072940_1038413 Ga0072940_10384131 416
32 3300042599 Ga0466706_106107 Ga0466706_106107_3285_4535 416
33 3300042599 Ga0466706_106112 Ga0466706_106112_16169_17419 416
34 3300042599 Ga0466706_112267 Ga0466706_112267_11323_12573 416
35 3300042599 Ga0466706_168401 Ga0466706_168401_5376_6626 416
36 3300042599 Ga0466706_237121 Ga0466706_237121_1556_2806 416
37 3300042599 Ga0466706_260176 Ga0466706_260176_1774_3024 416
38 3300042603 Ga0466714_031203 Ga0466714_031203_2200_3450 416
39 3300042603 Ga0466714_048716 Ga0466714_048716_1735_2985 416
40 3300042603 Ga0466714_105065 Ga0466714_105065_1487_2737 416
41 3300042659 Ga0466733_206607 Ga0466733_206607_8930_10180 416
42 3300042659 Ga0466733_211526 Ga0466733_211526_2782_4032 416
43 iso_pr_bacteria 2820768849 2820769767 416
44 iso_pr_bacteria 2820774381 2820775151 416
45 iso_pr_bacteria 2873776654 2873777675 416
46 3300010167 Ga0123353_10000019 Ga0123353_10000019151 417
47 3300012803 Ga0160465_100039 Ga0160465_10003977 417
48 3300012812 Ga0160471_100015 Ga0160471_100015268 417
49 3300012847 Ga0160445_100158 Ga0160445_10015821 417
50 3300042599 Ga0466706_022785 Ga0466706_022785_1858_3141 417
51 3300042659 Ga0466733_095851 Ga0466733_095851_31_1284 417
52 3300042590 Ga0466690_034180 Ga0466690_034180_178_1434 418
53 3300010167 Ga0123353_10098483 Ga0123353_100984832 419
54 3300042616 Ga0466715_488221 Ga0466715_488221_1708_2967 419
55 3300042643 Ga0466704_463112 Ga0466704_463112_4854_6113 419
56 3300042652 Ga0466708_186550 Ga0466708_186550_1282_2541 419
57 3300042612 Ga0466705_266468 Ga0466705_266468_5274_6536 420
58 3300042615 Ga0466711_107677 Ga0466711_107677_2464_3726 420
59 3300042624 Ga0466735_215070 Ga0466735_215070_74_1336 420
60 3300042655 Ga0466727_092227 Ga0466727_092227_12449_13711 420
61 iso_pr_bacteria 2524614537 2524833091 420
62 iso_pr_bacteria 2537562000 2539435717 420
63 iso_pr_bacteria 2561511170 2562331840 420
64 iso_pr_bacteria 2563367190 2565791017 420
65 iso_pr_bacteria 2751185832 2753509368 420
66 iso_pr_bacteria 2822232166 2822233623 420
67 iso_pr_bacteria 2822450720 2822451319 420
68 iso_pr_bacteria 2843246524 2843250787 420
69 iso_pr_bacteria 2852123468 2852127767 420
70 iso_pr_bacteria 2855361764 2855362926 420
71 iso_pr_bacteria 2864782175 2864782622 420
72 iso_pr_bacteria 2890957088 2890957443 420
73 iso_pr_bacteria 2912849059 2912850793 420
74 iso_pr_bacteria 2916873227 2916875799 420
75 iso_pr_bacteria 2969145278 2969147178 420
76 iso_pr_bacteria 2978778678 2978781750 420
77 iso_pr_bacteria 3002002099 3002002185 420
78 iso_pr_bacteria 643886085 644679254 420
79 iso_pr_bacteria 643886087 644667065 420
80 iso_pr_bacteria 643886090 644660939 420
81 iso_pr_bacteria 643886091 644647896 420
82 iso_pr_bacteria 8022725327 8022728062 420
83 iso_pr_bacteria 8022781829 8022783884 420
84 iso_pr_bacteria 8061039349 8061045739 420
85 iso_pr_bacteria 8061045771 8061050061 420
86 iso_pr_bacteria 8061100935 8061106381 420
87 3300003973 Ga0063521_1000197 Ga0063521_100019735 421
88 3300042593 Ga0466691_041949 Ga0466691_041949_924_2189 421
89 3300042593 Ga0466691_149175 Ga0466691_149175_10483_11748 421
90 3300042612 Ga0466705_074507 Ga0466705_074507_16210_17475 421
91 3300042615 Ga0466711_062624 Ga0466711_062624_268_1533 421
92 3300042616 Ga0466715_185011 Ga0466715_185011_8338_9603 421
93 3300042618 Ga0466723_154051 Ga0466723_154051_8988_10253 421
94 3300042652 Ga0466708_253658 Ga0466708_253658_7384_8649 421
95 3300042652 Ga0466708_359907 Ga0466708_359907_13626_14891 421
96 iso_pr_bacteria 2518645548 2518801557 421
97 iso_pr_bacteria 2838772460 2838774533 421
98 iso_pr_bacteria 2894649344 2894652543 421
99 iso_pr_bacteria 3001995318 3001995405 421
100 iso_pr_bacteria 3002002726 3002002815 421
101 iso_pr_bacteria 3002005847 3002005933 421
102 iso_pr_bacteria 3002007112 3002007199 421
103 iso_pr_bacteria 3002007740 3002007826 421
104 iso_pr_bacteria 3002008367 3002008452 421
105 iso_pr_bacteria 3002008998 3002009087 421
106 iso_pr_bacteria 3002023891 3002023977 421
107 iso_pr_bacteria 3002026852 3002026937 421
108 iso_pr_bacteria 3002028747 3002028829 421
109 iso_pr_bacteria 3002029927 3002030011 421
110 iso_pr_bacteria 3002030550 3002030636 421
111 iso_pr_bacteria 3002033046 3002033134 421
112 iso_pr_bacteria 646311912 646377310 421
113 iso_pr_bacteria 650716011 650720320 421
114 3300042612 Ga0466705_307804 Ga0466705_307804_498_1766 422
115 3300042659 Ga0466733_138126 Ga0466733_138126_51470_52738 422
116 iso_pr_bacteria 2916858470 2916862490 422
117 iso_pr_bacteria 3002003370 3002003456 422
118 iso_pr_bacteria 3002004002 3002004089 422
119 iso_pr_bacteria 3002006476 3002006562 422
120 iso_pr_bacteria 3002024525 3002024612 422
121 iso_pr_bacteria 3002025161 3002025235 422
122 iso_pr_bacteria 3002032411 3002032495 422
123 iso_pr_bacteria 8064008355 8064011120 422
124 3300012809 Ga0160466_100434 Ga0160466_10043419 423
125 iso_pr_bacteria 2864981449 2864984832 423
126 iso_pr_bacteria 3002028123 3002028212 423
127 iso_pr_bacteria 8065497608 8065498648 424
128 iso_pr_bacteria 2864836148 2864836367 425
129 3300042599 Ga0466706_104029 Ga0466706_104029_7538_8821 427
130 3300042603 Ga0466714_032968 Ga0466714_032968_1183_2466 427
131 3300042603 Ga0466714_060488 Ga0466714_060488_807_2090 427
132 3300042619 Ga0466726_039461 Ga0466726_039461_2542_3825 427
133 3300042619 Ga0466726_321113 Ga0466726_321113_213_1496 427
134 3300042659 Ga0466733_073991 Ga0466733_073991_631_1914 427
135 iso_pr_bacteria 8002519755 8002520740 428
136 3300042603 Ga0466714_073459 Ga0466714_073459_1364_2665 433
137 3300012845 Ga0160460_100222 Ga0160460_10022232 449
138 3300042620 Ga0466728_122697 Ga0466728_122697_4207_5595 462
139 3300024493 Ga0264413_156421 Ga0264413_1564212 482

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00585 Thr_dehydrat_C C-terminal regulatory domain of Threonine dehydratase 322 414 0.98
PF00291 PALP Pyridoxal-phosphate dependent enzyme 21 309 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.