Protein Family IF04193

Metagenome Isolate
202 Members
72 Samples
190 Scaffolds
325.94 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_140667|Ga0264413_1406672
Length
369 aa
Sequence
MMNGITFHNPEFLYLLFCLPLLAGWKWWRHKRTVAKISVSNIELLAVAKKSLRQRLMVLPFVLRLLTLTILVIAMARPQSSLKGRQENIEGVDIMLALDISGSMLAEDFLPNRMEAAKSVAADFVRSRPSDRMGIVVFSGESFTQCPLTIDHSILLSQIDAIKTGMIEDGTAIGDGLATAINRLKNSTAISKTIILLTDGVNNMGSIAPITAAEIASVYGIRVYTIGVGTHGTAPYPFQTPFGKQYQNVEVQLDEPMLKQMAETTGGQYFRATNKNKLKAIFEDIDKMEKTKIEVLNYERKHEEFKLLLWIALGLFLLELLLSYSXXXXSAIRVESRKSTTSRCGFDDLFGHFGKYECRRHPAQSFETL

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.7%
Unclassified 22.1%
Kalotermitidae 20.6%
Termopsidae 5.9%
Armadillidiidae 4.4%
Passalidae 2.9%
Hodotermitidae 1.5%
Culicidae 1.5%
Rhinotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 192
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
2 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
13 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
28 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
31 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
36 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
37 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
38 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
49 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
50 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
51 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
54 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
55 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
59 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
60 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
61 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
62 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
63 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
67 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
68 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
69 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
71 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_326852 3300042615 Bacteria 4197
2 Ga0466715_142775 3300042616 Unclassified 5955
3 Ga0466715_470278 3300042616 Bacteria 8666
4 Ga0466715_478991 3300042616 Unclassified 15299
5 Ga0466723_042859 3300042618 Bacteria 12089
6 Ga0466723_287880 3300042618 Bacteria 4213
7 Ga0466726_444394 3300042619 Bacteria 1576
8 Ga0466728_232878 3300042620 Bacteria 14732
9 Ga0466728_235470 3300042620 Bacteria 23707
10 Ga0123355_10006152 3300009826 Bacteria 17714
11 Ga0123356_10189982 3300010049 Bacteria 2084
12 Ga0123353_10000019 3300010167 Bacteria 185006
13 Ga0123353_10002109 3300010167 Bacteria 24588
14 Ga0123353_10066470 3300010167 Bacteria 5787
15 Ga0123354_10344472 3300010882 Bacteria 1338
16 Ga0466706_021104 3300042599 Bacteria 37411
17 Ga0466700_015001 3300042600 Bacteria 10860
18 Ga0466714_005263 3300042603 Bacteria 18418
19 Ga0466714_102912 3300042603 Bacteria 25171
20 Ga0466721_160779 3300042608 Bacteria 21993
21 Ga0466722_214424 3300042609 Bacteria 4734
22 Ga0466704_333042 3300042643 Bacteria 20009
23 Ga0466709_204440 3300042648 Bacteria 87623
24 Ga0466708_119301 3300042652 Unclassified 1081
25 Ga0466727_303900 3300042655 Bacteria 4546
26 Ga0466656_132996 3300042550 Bacteria 1202
27 Ga0466691_016435 3300042593 Bacteria 9445
28 JGI24702J35022_10000076 3300002462 Bacteria 43662
29 JGI24702J35022_10003685 3300002462 Bacteria 9219
30 Ga0466732_343472 3300042656 Bacteria 1855
31 Ga0466733_003820 3300042659 Bacteria 5829
32 Ga0466733_117641 3300042659 Bacteria 3338
33 Ga0466711_268649 3300042615 Bacteria 10972
34 Ga0466711_363285 3300042615 Bacteria 32228
35 Ga0466715_530925 3300042616 Bacteria 21537
36 Ga0466723_107788 3300042618 Bacteria 1468
37 Ga0466728_016252 3300042620 Bacteria 1684
38 Ga0123355_10000217 3300009826 Bacteria 72204
39 Ga0123356_10089583 3300010049 Bacteria 2927
40 Ga0123353_10165476 3300010167 Unclassified 3516
41 Ga0123354_10052709 3300010882 Bacteria 6125
42 Ga0466706_070252 3300042599 Bacteria 1785
43 Ga0466716_141048 3300042605 Bacteria 6242
44 Ga0466716_166894 3300042605 Bacteria 8161
45 Ga0466722_242773 3300042609 Bacteria 10208
46 Ga0466734_048441 3300042623 Bacteria 1958
47 Ga0466735_208382 3300042624 Bacteria 2247
48 Ga0466704_605489 3300042643 Bacteria 25005
49 Ga0466725_332927 3300042654 Bacteria 2692
50 Ga0466727_128385 3300042655 Bacteria 2660
51 Ga0160452_101837 3300012834 Bacteria 5387
52 Ga0466657_357223 3300042582 Bacteria 5077
53 Ga0466690_226424 3300042590 Bacteria 22270
54 Ga0466693_028517 3300042592 Bacteria 3697
55 Ga0466694_085252 3300042594 Bacteria 1509
56 Ga0466696_292450 3300042596 Bacteria 2408
57 JGI24705J35276_12238193 3300002504 Bacteria 17080
58 Ga0466705_422513 3300042612 Bacteria 14401
59 Ga0466705_477694 3300042612 Bacteria 20351
60 Ga0466711_032112 3300042615 Bacteria 6208
61 Ga0466723_008388 3300042618 Bacteria 3922
62 Ga0466723_152589 3300042618 Bacteria 2420
63 Ga0466726_048383 3300042619 Bacteria 29520
64 Ga0466728_071249 3300042620 Bacteria 13016
65 Ga0466706_178803 3300042599 Bacteria 1798
66 Ga0466706_196142 3300042599 Bacteria 22966
67 Ga0466706_288797 3300042599 Bacteria 1467
68 Ga0466707_198931 3300042601 Bacteria 8885
69 Ga0466713_035670 3300042602 Bacteria 9093
70 Ga0466713_070006 3300042602 Bacteria 89523
71 Ga0466714_031378 3300042603 Bacteria 17961
72 Ga0466719_234854 3300042606 Bacteria 2797
73 Ga0466698_359284 3300042610 Bacteria 1495
74 Ga0466703_057665 3300042636 Bacteria 22398
75 Ga0466709_339484 3300042648 Bacteria 169915
76 Ga0466724_65632 3300042649 Bacteria 2424
77 Ga0160431_101799 3300012828 Bacteria 5647
78 Ga0264413_140667 3300024493 Bacteria 1869
79 Ga0466657_016523 3300042582 Bacteria 6840
80 Ga0466690_140491 3300042590 Bacteria 5286
81 Ga0466690_349805 3300042590 Bacteria 10041
82 Ga0466696_232902 3300042596 Bacteria 1706
83 2227591276 2225789004 Bacteria 49034
84 IMNBL1DRAFT_c0000483 3300000062 Bacteria 33213
85 Ga0072941_1137062 3300005201 Bacteria 3773
86 Ga0466705_211281 3300042612 Bacteria 10258
87 Ga0466732_355038 3300042656 Bacteria 1834
88 Ga0466733_061170 3300042659 Bacteria 1655
89 Ga0466711_018792 3300042615 Bacteria 12875
90 Ga0466723_352722 3300042618 Bacteria 5727
91 Ga0466728_218884 3300042620 Unclassified 1681
92 Ga0123353_10165554 3300010167 Bacteria 3515
93 Ga0466706_048142 3300042599 Bacteria 37807
94 Ga0466706_165313 3300042599 Bacteria 60368
95 Ga0466713_005148 3300042602 Bacteria 13984
96 Ga0466714_018521 3300042603 Bacteria 46643
97 Ga0466719_352394 3300042606 Bacteria 20000
98 Ga0466719_509966 3300042606 Bacteria 7822
99 Ga0466722_217106 3300042609 Bacteria 2910
100 Ga0466730_010897 3300042625 Bacteria 2402
101 Ga0466703_362470 3300042636 Bacteria 4438
102 Ga0466704_050971 3300042643 Bacteria 11653
103 Ga0466709_308187 3300042648 Bacteria 11943
104 Ga0466690_170601 3300042590 Bacteria 1472
105 Ga0466691_055360 3300042593 Bacteria 60253
106 Ga0466699_196665 3300042597 Bacteria 2770
107 IMNBL1DRAFT_c0009827 3300000062 Bacteria 4667
108 JGI24702J35022_10010005 3300002462 Bacteria 5314
109 Ga0068302_10021604 3300005071 Unclassified 2236
110 Ga0072940_1204458 3300005200 Bacteria 1810
111 Ga0466697_082818 3300042611 Bacteria 2021
112 Ga0466733_020123 3300042659 Bacteria 4206
113 Ga0466728_048806 3300042620 Bacteria 9925
114 Ga0123356_10502590 3300010049 Bacteria 1368
115 Ga0466706_002839 3300042599 Bacteria 28488
116 Ga0466713_057198 3300042602 Bacteria 57543
117 Ga0466722_059338 3300042609 Bacteria 9524
118 Ga0466703_143580 3300042636 Bacteria 20242
119 Ga0466703_160265 3300042636 Bacteria 23736
120 Ga0466703_168329 3300042636 Bacteria 3242
121 Ga0466704_136608 3300042643 Bacteria 15825
122 Ga0466709_182379 3300042648 Bacteria 13931
123 Ga0466727_139416 3300042655 Bacteria 8928
124 Ga0466656_381850 3300042550 Unclassified 5457
125 Ga0466693_105274 3300042592 Bacteria 2315
126 Ga0466691_164012 3300042593 Unclassified 2206
127 Ga0466696_111122 3300042596 Bacteria 5174
128 Ga0466696_476890 3300042596 Bacteria 6050
129 2227591283 2225789004 Bacteria 48146
130 Ga0068302_10375961 3300005071 Bacteria 2747
131 Ga0466710_440248 3300042613 Bacteria 5620
132 Ga0466723_131247 3300042618 Bacteria 27370
133 Ga0466723_158422 3300042618 Bacteria 5611
134 Ga0123356_10072933 3300010049 Bacteria 3227
135 Ga0466706_125597 3300042599 Bacteria 31503
136 Ga0466719_546936 3300042606 Bacteria 12915
137 Ga0466734_041052 3300042623 Bacteria 2530
138 Ga0466735_035697 3300042624 Bacteria 10327
139 Ga0466703_275744 3300042636 Bacteria 14473
140 Ga0466704_020070 3300042643 Bacteria 4474
141 Ga0466708_053789 3300042652 Bacteria 4201
142 Ga0466708_368256 3300042652 Bacteria 26611
143 Ga0160455_100163 3300012837 Bacteria 72594
144 Ga0160457_1001675 3300012858 Bacteria 5671
145 Ga0466690_129997 3300042590 Unclassified 3034
146 Ga0466690_426101 3300042590 Bacteria 4218
147 Ga0466691_179572 3300042593 Bacteria 130258
148 Ga0466710_435486 3300042613 Bacteria 1869
149 Ga0466712_152888 3300042614 Bacteria 2164
150 Ga0466715_080397 3300042616 Bacteria 7925
151 Ga0466723_203874 3300042618 Bacteria 22262
152 Ga0123355_10000161 3300009826 Bacteria 81946
153 Ga0466707_414097 3300042601 Bacteria 13795
154 Ga0466713_035234 3300042602 Bacteria 43574
155 Ga0466713_042132 3300042602 Bacteria 1693
156 Ga0466713_073620 3300042602 Bacteria 10146
157 Ga0466716_048826 3300042605 Bacteria 7788
158 Ga0466731_048332 3300042622 Bacteria 1592
159 Ga0466731_069008 3300042622 Bacteria 1725
160 Ga0466703_029191 3300042636 Bacteria 4361
161 Ga0466703_044193 3300042636 Bacteria 5224
162 Ga0466724_33726 3300042649 Bacteria 1039
163 Ga0466708_184382 3300042652 Bacteria 8225
164 Ga0466708_221398 3300042652 Bacteria 32840
165 Ga0466727_224993 3300042655 Bacteria 12098
166 Ga0160433_100027 3300012846 Bacteria 176280
167 Ga0160448_104627 3300012854 Bacteria 3786
168 Ga0466690_113107 3300042590 Unclassified 4145
169 Ga0466696_031548 3300042596 Bacteria 10280
170 Ga0466696_049113 3300042596 Bacteria 63300
171 IMNBL1DRAFT_c0006134 3300000062 Bacteria 6653
172 Ga0068305_10074442 3300005083 Bacteria 15489
173 Ga0466705_133667 3300042612 Bacteria 38257
174 Ga0466705_160845 3300042612 Bacteria 6396
175 Ga0466705_218445 3300042612 Bacteria 3510
176 Ga0466710_002707 3300042613 Bacteria 15470
177 Ga0466715_068346 3300042616 Bacteria 14735
178 Ga0123353_10071832 3300010167 Bacteria 5561
179 Ga0466706_040830 3300042599 Bacteria 11106
180 Ga0466714_166348 3300042603 Bacteria 7399
181 Ga0466719_244564 3300042606 Bacteria 6273
182 Ga0466722_222249 3300042609 Bacteria 5237
183 Ga0466734_118681 3300042623 Bacteria 3166
184 Ga0466709_237040 3300042648 Bacteria 13320
185 Ga0466708_094334 3300042652 Bacteria 1394
186 Ga0466690_366148 3300042590 Bacteria 9728
187 Ga0466691_207490 3300042593 Bacteria 15619
188 Ga0466695_178590 3300042595 Bacteria 10907
189 IMNBL1DRAFT_c0008230 3300000062 Bacteria 5340
190 IMNBL1DRAFT_c0031038 3300000062 Bacteria 1949

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_113107 Ga0466690_113107_13_876 270
2 3300042613 Ga0466710_002707 Ga0466710_002707_689_1519 276
3 3300042616 Ga0466715_142775 Ga0466715_142775_871_1740 289
4 3300042590 Ga0466690_140491 Ga0466690_140491_3292_4167 291
5 3300042619 Ga0466726_048383 Ga0466726_048383_610_1494 294
6 3300042590 Ga0466690_129997 Ga0466690_129997_959_1849 296
7 3300042593 Ga0466691_164012 Ga0466691_164012_741_1631 296
8 3300042594 Ga0466694_085252 Ga0466694_085252_287_1177 296
9 3300042618 Ga0466723_352722 Ga0466723_352722_3355_4245 296
10 3300042648 Ga0466709_182379 Ga0466709_182379_5002_5904 300
11 3300042605 Ga0466716_141048 Ga0466716_141048_3709_4698 301
12 3300042602 Ga0466713_035234 Ga0466713_035234_6903_7889 302
13 3300042624 Ga0466735_035697 Ga0466735_035697_6202_7116 304
14 3300042649 Ga0466724_33726 Ga0466724_33726_67_981 304
15 3300042593 Ga0466691_207490 Ga0466691_207490_3528_4517 305
16 3300042623 Ga0466734_048441 Ga0466734_048441_530_1516 309
17 3300042612 Ga0466705_477694 Ga0466705_477694_7233_8222 311
18 3300042620 Ga0466728_232878 Ga0466728_232878_4951_5937 311
19 3300042620 Ga0466728_235470 Ga0466728_235470_17102_18076 311
20 3300042643 Ga0466704_050971 Ga0466704_050971_2943_3929 311
21 3300042655 Ga0466727_303900 Ga0466727_303900_451_1437 311
22 3300000062 IMNBL1DRAFT_c0009827 IMNBL1DRAFT_00098273 312
23 3300042590 Ga0466690_226424 Ga0466690_226424_14046_15035 312
24 3300042602 Ga0466713_005148 Ga0466713_005148_837_1775 312
25 3300042602 Ga0466713_057198 Ga0466713_057198_40604_41596 312
26 3300042603 Ga0466714_018521 Ga0466714_018521_40228_41166 312
27 3300042606 Ga0466719_546936 Ga0466719_546936_6994_7983 312
28 3300042618 Ga0466723_131247 Ga0466723_131247_18593_19582 312
29 3300042643 Ga0466704_333042 Ga0466704_333042_11955_12947 312
30 3300042616 Ga0466715_530925 Ga0466715_530925_13293_14282 313
31 3300042636 Ga0466703_143580 Ga0466703_143580_1018_2007 313
32 3300042599 Ga0466706_165313 Ga0466706_165313_35793_36791 315
33 3300042605 Ga0466716_048826 Ga0466716_048826_1493_2479 315
34 3300042615 Ga0466711_363285 Ga0466711_363285_7983_8972 315
35 3300042618 Ga0466723_107788 Ga0466723_107788_126_1112 315
36 3300042618 Ga0466723_152589 Ga0466723_152589_126_1112 315
37 3300042636 Ga0466703_160265 Ga0466703_160265_17910_18896 315
38 3300042652 Ga0466708_221398 Ga0466708_221398_27893_28879 315
39 iso_pr_bacteria 2820748953 2820750137 315
40 3300042593 Ga0466691_016435 Ga0466691_016435_3135_4121 316
41 3300042599 Ga0466706_125597 Ga0466706_125597_13968_14957 317
42 3300042602 Ga0466713_070006 Ga0466713_070006_74634_75614 317
43 3300042602 Ga0466713_073620 Ga0466713_073620_7819_8811 317
44 3300042636 Ga0466703_168329 Ga0466703_168329_2159_3142 317
45 3300005200 Ga0072940_1204458 Ga0072940_12044582 318
46 3300042595 Ga0466695_178590 Ga0466695_178590_8312_9316 318
47 3300042612 Ga0466705_422513 Ga0466705_422513_5464_6459 318
48 3300002462 JGI24702J35022_10000076 JGI24702J35022_100000768 319
49 3300002462 JGI24702J35022_10003685 JGI24702J35022_1000368510 319
50 3300010167 Ga0123353_10002109 Ga0123353_1000210912 320
51 3300042550 Ga0466656_381850 Ga0466656_381850_844_1839 320
52 3300042608 Ga0466721_160779 Ga0466721_160779_5447_6433 320
53 3300042648 Ga0466709_237040 Ga0466709_237040_3312_4274 320
54 3300010167 Ga0123353_10066470 Ga0123353_100664702 321
55 3300042609 Ga0466722_217106 Ga0466722_217106_1472_2452 321
56 3300012846 Ga0160433_100027 Ga0160433_10002758 322
57 3300042606 Ga0466719_352394 Ga0466719_352394_10692_11681 322
58 3300042615 Ga0466711_268649 Ga0466711_268649_6139_7125 322
59 3300042612 Ga0466705_133667 Ga0466705_133667_16888_17889 323
60 3300042615 Ga0466711_032112 Ga0466711_032112_2292_3314 323
61 3300042618 Ga0466723_203874 Ga0466723_203874_9831_10820 323
62 3300042643 Ga0466704_020070 Ga0466704_020070_1543_2553 323
63 3300042643 Ga0466704_136608 Ga0466704_136608_11941_12942 323
64 3300042602 Ga0466713_042132 Ga0466713_042132_175_1149 324
65 3300042603 Ga0466714_005263 Ga0466714_005263_5657_6634 325
66 3300042636 Ga0466703_057665 Ga0466703_057665_7294_8295 325
67 3300042550 Ga0466656_132996 Ga0466656_132996_141_1121 326
68 3300042601 Ga0466707_198931 Ga0466707_198931_3889_4869 326
69 3300042606 Ga0466719_509966 Ga0466719_509966_1250_2230 326
70 3300042609 Ga0466722_059338 Ga0466722_059338_2870_3874 326
71 3300042609 Ga0466722_214424 Ga0466722_214424_1728_2708 326
72 3300042616 Ga0466715_068346 Ga0466715_068346_9531_10511 326
73 3300042623 Ga0466734_041052 Ga0466734_041052_896_1906 326
74 3300042624 Ga0466735_208382 Ga0466735_208382_1234_2214 326
75 3300010882 Ga0123354_10344472 Ga0123354_103444722 327
76 3300042596 Ga0466696_031548 Ga0466696_031548_5399_6382 327
77 3300042643 Ga0466704_605489 Ga0466704_605489_8397_9380 327
78 3300042655 Ga0466727_139416 Ga0466727_139416_5392_6375 327
79 2225789004 2227591283 2228150653 328
80 3300009826 Ga0123355_10006152 Ga0123355_100061528 328
81 3300042590 Ga0466690_170601 Ga0466690_170601_228_1214 328
82 3300042611 Ga0466697_082818 Ga0466697_082818_254_1240 328
83 3300042612 Ga0466705_160845 Ga0466705_160845_3822_4808 328
84 3300042614 Ga0466712_152888 Ga0466712_152888_457_1443 328
85 3300042616 Ga0466715_080397 Ga0466715_080397_4895_5881 328
86 3300042618 Ga0466723_158422 Ga0466723_158422_4449_5435 328
87 3300042619 Ga0466726_444394 Ga0466726_444394_362_1348 328
88 3300042625 Ga0466730_010897 Ga0466730_010897_860_1846 328
89 3300042636 Ga0466703_044193 Ga0466703_044193_2290_3276 328
90 3300042655 Ga0466727_224993 Ga0466727_224993_836_1822 328
91 3300042656 Ga0466732_343472 Ga0466732_343472_843_1829 328
92 iso_pr_bacteria 2820740053 2820741285 328
93 iso_pr_bacteria 2820767225 2820768000 328
94 iso_pr_bacteria 2820772500 2820772641 328
95 3300000062 IMNBL1DRAFT_c0006134 IMNBL1DRAFT_00061344 329
96 3300000062 IMNBL1DRAFT_c0031038 IMNBL1DRAFT_00310382 329
97 3300002504 JGI24705J35276_12238193 JGI24705J35276_1223819311 329
98 3300010049 Ga0123356_10089583 Ga0123356_100895833 329
99 3300010167 Ga0123353_10071832 Ga0123353_100718325 329
100 3300010167 Ga0123353_10165476 Ga0123353_101654763 329
101 3300010167 Ga0123353_10165554 Ga0123353_101655544 329
102 3300042590 Ga0466690_349805 Ga0466690_349805_4319_5308 329
103 3300042605 Ga0466716_166894 Ga0466716_166894_4773_5762 329
104 3300042648 Ga0466709_308187 Ga0466709_308187_4679_5668 329
105 3300042652 Ga0466708_368256 Ga0466708_368256_16527_17537 329
106 3300042656 Ga0466732_355038 Ga0466732_355038_798_1787 329
107 3300042659 Ga0466733_117641 Ga0466733_117641_861_1850 329
108 3300002462 JGI24702J35022_10010005 JGI24702J35022_100100055 330
109 3300005071 Ga0068302_10375961 Ga0068302_103759612 330
110 3300005201 Ga0072941_1137062 Ga0072941_11370623 330
111 3300042582 Ga0466657_357223 Ga0466657_357223_937_1929 330
112 3300042593 Ga0466691_055360 Ga0466691_055360_38422_39414 330
113 3300042593 Ga0466691_179572 Ga0466691_179572_36443_37435 330
114 3300042596 Ga0466696_292450 Ga0466696_292450_344_1336 330
115 3300042599 Ga0466706_002839 Ga0466706_002839_13925_14917 330
116 3300042599 Ga0466706_021104 Ga0466706_021104_24461_25453 330
117 3300042599 Ga0466706_040830 Ga0466706_040830_2116_3108 330
118 3300042599 Ga0466706_048142 Ga0466706_048142_7665_8657 330
119 3300042599 Ga0466706_178803 Ga0466706_178803_132_1124 330
120 3300042599 Ga0466706_196142 Ga0466706_196142_4763_5755 330
121 3300042599 Ga0466706_288797 Ga0466706_288797_136_1128 330
122 3300042603 Ga0466714_166348 Ga0466714_166348_2516_3508 330
123 3300042615 Ga0466711_018792 Ga0466711_018792_5734_6726 330
124 3300042622 Ga0466731_069008 Ga0466731_069008_170_1162 330
125 3300042636 Ga0466703_362470 Ga0466703_362470_958_1950 330
126 3300042648 Ga0466709_339484 Ga0466709_339484_5953_6945 330
127 3300042649 Ga0466724_65632 Ga0466724_65632_73_1065 330
128 3300005083 Ga0068305_10074442 Ga0068305_1007444210 331
129 3300042582 Ga0466657_016523 Ga0466657_016523_1737_2732 331
130 3300042613 Ga0466710_435486 Ga0466710_435486_799_1794 331
131 3300042613 Ga0466710_440248 Ga0466710_440248_2172_3167 331
132 3300042659 Ga0466733_003820 Ga0466733_003820_1551_2546 331
133 3300042659 Ga0466733_061170 Ga0466733_061170_172_1167 331
134 iso_pr_bacteria 2820746860 2820747091 331
135 2225789004 2227591276 2228150306 332
136 3300042596 Ga0466696_476890 Ga0466696_476890_3424_4422 332
137 3300042615 Ga0466711_326852 Ga0466711_326852_2188_3186 332
138 3300042648 Ga0466709_204440 Ga0466709_204440_14927_15925 332
139 3300042659 Ga0466733_020123 Ga0466733_020123_2853_3851 332
140 iso_pr_bacteria 2820750388 2820751440 332
141 3300000062 IMNBL1DRAFT_c0000483 IMNBL1DRAFT_00004836 333
142 3300000062 IMNBL1DRAFT_c0008230 IMNBL1DRAFT_00082302 333
143 3300042603 Ga0466714_102912 Ga0466714_102912_15234_16235 333
144 3300042636 Ga0466703_029191 Ga0466703_029191_2213_3214 333
145 iso_pr_bacteria 2820768849 2820769635 333
146 iso_pr_bacteria 2820774381 2820774736 333
147 3300010167 Ga0123353_10000019 Ga0123353_1000001920 334
148 3300012834 Ga0160452_101837 Ga0160452_1018373 334
149 3300012837 Ga0160455_100163 Ga0160455_10016369 334
150 3300042592 Ga0466693_105274 Ga0466693_105274_314_1318 334
151 3300042600 Ga0466700_015001 Ga0466700_015001_5964_6968 334
152 iso_pr_bacteria 2820785563 2820786132 334
153 iso_pr_bacteria 2820788205 2820788621 334
154 3300009826 Ga0123355_10000161 Ga0123355_100001613 335
155 3300009826 Ga0123355_10000217 Ga0123355_1000021760 335
156 3300010049 Ga0123356_10072933 Ga0123356_100729332 335
157 3300010049 Ga0123356_10502590 Ga0123356_105025901 335
158 3300012828 Ga0160431_101799 Ga0160431_1017992 335
159 3300012858 Ga0160457_1001675 Ga0160457_10016752 335
160 3300042596 Ga0466696_232902 Ga0466696_232902_68_1075 335
161 3300042609 Ga0466722_222249 Ga0466722_222249_1357_2364 335
162 iso_pr_bacteria 2820770630 2820772187 335
163 3300012854 Ga0160448_104627 Ga0160448_1046274 336
164 3300042590 Ga0466690_366148 Ga0466690_366148_984_1994 336
165 3300042590 Ga0466690_426101 Ga0466690_426101_1352_2362 336
166 3300042596 Ga0466696_049113 Ga0466696_049113_23945_24955 336
167 3300042596 Ga0466696_111122 Ga0466696_111122_1805_2815 336
168 3300042612 Ga0466705_211281 Ga0466705_211281_7373_8383 336
169 3300042618 Ga0466723_042859 Ga0466723_042859_2912_3922 336
170 3300042618 Ga0466723_287880 Ga0466723_287880_1995_3005 336
171 3300042620 Ga0466728_016252 Ga0466728_016252_617_1627 336
172 3300042620 Ga0466728_048806 Ga0466728_048806_6895_7905 336
173 3300042620 Ga0466728_071249 Ga0466728_071249_1904_2914 336
174 3300042620 Ga0466728_218884 Ga0466728_218884_614_1624 336
175 3300042636 Ga0466703_275744 Ga0466703_275744_1495_2505 336
176 3300042652 Ga0466708_053789 Ga0466708_053789_1292_2302 336
177 3300042652 Ga0466708_094334 Ga0466708_094334_13_1023 336
178 3300042652 Ga0466708_119301 Ga0466708_119301_13_1023 336
179 3300042652 Ga0466708_184382 Ga0466708_184382_6844_7854 336
180 3300042655 Ga0466727_128385 Ga0466727_128385_1061_2071 336
181 3300005071 Ga0068302_10021604 Ga0068302_100216043 337
182 3300042606 Ga0466719_234854 Ga0466719_234854_650_1663 337
183 3300042606 Ga0466719_244564 Ga0466719_244564_1806_2819 337
184 3300042610 Ga0466698_359284 Ga0466698_359284_70_1083 337
185 3300042612 Ga0466705_218445 Ga0466705_218445_990_2003 337
186 3300042616 Ga0466715_478991 Ga0466715_478991_11483_12496 337
187 3300042618 Ga0466723_008388 Ga0466723_008388_1860_2873 337
188 3300010882 Ga0123354_10052709 Ga0123354_100527092 338
189 3300042592 Ga0466693_028517 Ga0466693_028517_990_2006 338
190 3300042597 Ga0466699_196665 Ga0466699_196665_1521_2537 338
191 3300042601 Ga0466707_414097 Ga0466707_414097_3478_4494 338
192 3300042609 Ga0466722_242773 Ga0466722_242773_3194_4210 338
193 3300042616 Ga0466715_470278 Ga0466715_470278_3647_4663 338
194 3300042622 Ga0466731_048332 Ga0466731_048332_267_1283 338
195 3300042623 Ga0466734_118681 Ga0466734_118681_489_1505 338
196 3300042654 Ga0466725_332927 Ga0466725_332927_1356_2372 338
197 iso_pr_bacteria 2820744581 2820746086 338
198 3300010049 Ga0123356_10189982 Ga0123356_101899822 339
199 3300042602 Ga0466713_035670 Ga0466713_035670_5057_6082 341
200 3300042599 Ga0466706_070252 Ga0466706_070252_612_1694 360
201 3300042603 Ga0466714_031378 Ga0466714_031378_4130_5224 364
202 3300024493 Ga0264413_140667 Ga0264413_1406672 369

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13519 VWA_2 von Willebrand factor type A domain 94 200 0.98
PF07584 BatA Aerotolerance regulator N-terminal 2 78 0.94
PF00092 VWA von Willebrand factor type A domain 93 283 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.