Protein Family IF04169

Metagenome Isolate
149 Members
37 Samples
140 Scaffolds
107.28 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_111305|Ga0264413_1113057
Length
125 aa
Sequence
MISGIKKPFIYNFIEKYMTAKKYTKADIIDALYEKTGMSRTEIRGAIDHLIDEMREALMRRQIIELRGLGTFEVKVRKARPRARNPRTGETITIRSHGAVTFRSGRDLKQAVWNITDDDKPAKKR

📊 Sample Types

Isolate 6.0%
Metagenome 94.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.7%
Unclassified 26.5%
Rhinotermitidae 8.8%

🌳 Taxonomy

Archaea 0
Bacteria 139
Eukaryota 0
Viruses 1
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
2 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
3 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
7 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
8 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
23 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
24 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
25 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
26 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
29 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10000453 3300010049 Bacteria 46109
2 Ga0123356_10020064 3300010049 Bacteria 6330
3 Ga0466712_056613 3300042614 Bacteria 12902
4 Ga0466718_149328 3300042617 Bacteria 9484
5 Ga0466692_082614 3300042591 Bacteria 2744
6 Ga0466692_087331 3300042591 Bacteria 1790
7 Ga0466694_081947 3300042594 Bacteria 6292
8 JGI24698J34947_10066562 3300002449 Bacteria 1752
9 JGI24695J34938_10000112 3300002450 Bacteria 72784
10 JGI24695J34938_10000553 3300002450 Bacteria 36121
11 JGI24695J34938_10001156 3300002450 Bacteria 23495
12 JGI24695J34938_10002792 3300002450 Bacteria 12795
13 JGI24695J34938_10003362 3300002450 Bacteria 11246
14 Ga0072941_1045063 3300005201 Bacteria 3140
15 Ga0466731_186790 3300042622 Bacteria 8951
16 Ga0466731_334782 3300042622 Viruses 8237
17 Ga0123356_10017470 3300010049 Bacteria 6824
18 Ga0123353_10138372 3300010167 Bacteria 3903
19 Ga0466712_064105 3300042614 Bacteria 16193
20 Ga0466712_149807 3300042614 Bacteria 5337
21 Ga0466718_006444 3300042617 Bacteria 75149
22 Ga0466718_047268 3300042617 Bacteria 7832
23 Ga0264413_112886 3300024493 Unclassified 1780
24 Ga0466693_316245 3300042592 Bacteria 9075
25 Ga0466699_186379 3300042597 Bacteria 1886
26 Ga0466699_386670 3300042597 Bacteria 1404
27 Ga0466699_425188 3300042597 Bacteria 97421
28 Ga0466700_157299 3300042600 Bacteria 11405
29 Ga0466720_048686 3300042607 Bacteria 8213
30 Ga0466720_226106 3300042607 Bacteria 4541
31 Ga0466722_032167 3300042609 Bacteria 1566
32 Ga0466722_246826 3300042609 Bacteria 2223
33 Ga0466698_398352 3300042610 Bacteria 4197
34 2230969608 2228664004 Bacteria 12014
35 AustNasuHG_c1082925 3300000089 Bacteria 536
36 JGI24695J34938_10031881 3300002450 Unclassified 2441
37 JGI24695J34938_10077805 3300002450 Unclassified 1375
38 Ga0466702_061015 3300042635 Bacteria 11994
39 Ga0123353_10130242 3300010167 Bacteria 4038
40 Ga0123353_10684888 3300010167 Bacteria 1443
41 Ga0466712_175957 3300042614 Bacteria 10105
42 Ga0466718_031808 3300042617 Bacteria 11464
43 Ga0466718_053207 3300042617 Bacteria 3487
44 Ga0466718_165921 3300042617 Bacteria 3153
45 Ga0466692_081109 3300042591 Bacteria 10324
46 Ga0466692_110321 3300042591 Bacteria 1347
47 Ga0466693_253926 3300042592 Bacteria 16135
48 Ga0466694_020203 3300042594 Bacteria 8825
49 Ga0466699_335402 3300042597 Bacteria 1091
50 AustNasuHG_c1000139 3300000089 Bacteria 22520
51 AustNasuHG_c1004102 3300000089 Bacteria 5234
52 AustNasuHG_c1018721 3300000089 Bacteria 2280
53 FAAS_10468750 3300001880 Bacteria 570
54 JGI24695J34938_10000947 3300002450 Bacteria 26470
55 JGI24695J34938_10049727 3300002450 Unclassified 1842
56 JGI24695J34938_10058596 3300002450 Unclassified 1651
57 Ga0466732_008846 3300042656 Bacteria 18049
58 Ga0466702_281606 3300042635 Bacteria 1375
59 Ga0466702_466217 3300042635 Bacteria 13914
60 Ga0466718_013194 3300042617 Bacteria 1472
61 Ga0466718_040204 3300042617 Bacteria 13075
62 Ga0264413_105646 3300024493 Bacteria 11070
63 Ga0466694_044360 3300042594 Bacteria 13614
64 Ga0466694_050416 3300042594 Bacteria 11268
65 Ga0466694_363261 3300042594 Bacteria 2213
66 Ga0466720_090063 3300042607 Bacteria 5155
67 Ga0466722_091193 3300042609 Bacteria 1135
68 AustNasuHG_c1000705 3300000089 Bacteria 11869
69 JGI24698J34947_10000003 3300002449 Bacteria 62691
70 JGI24698J34947_10000241 3300002449 Bacteria 22787
71 JGI24695J34938_10001512 3300002450 Bacteria 19609
72 Ga0072941_1036612 3300005201 Bacteria 2152
73 Ga0466730_017903 3300042625 Bacteria 2424
74 Ga0466712_050950 3300042614 Bacteria 10029
75 Ga0466712_112470 3300042614 Bacteria 9678
76 Ga0466718_025713 3300042617 Bacteria 9249
77 Ga0466718_032195 3300042617 Bacteria 6361
78 Ga0466718_078022 3300042617 Bacteria 5978
79 Ga0466718_143385 3300042617 Bacteria 10840
80 Ga0264413_105394 3300024493 Bacteria 9961
81 Ga0264413_114977 3300024493 Bacteria 37616
82 Ga0415639_067896 3300038395 Bacteria 4435
83 Ga0466695_357140 3300042595 Bacteria 35004
84 Ga0466699_159306 3300042597 Bacteria 2000
85 Ga0466722_262071 3300042609 Bacteria 23442
86 FAAS_10001006 3300001880 Bacteria 2683
87 JGI24698J34947_10006121 3300002449 Bacteria 6604
88 JGI24695J34938_10003321 3300002450 Bacteria 11335
89 Ga0072941_1032758 3300005201 Bacteria 9046
90 Ga0466732_429868 3300042656 Unclassified 4917
91 Ga0466731_140819 3300042622 Bacteria 1521
92 Ga0466731_146462 3300042622 Bacteria 2825
93 Ga0466702_004209 3300042635 Bacteria 8955
94 Ga0123356_10107073 3300010049 Bacteria 2693
95 Ga0466712_314821 3300042614 Bacteria 22070
96 Ga0264413_111305 3300024493 Bacteria 10078
97 Ga0415639_166680 3300038395 Bacteria 1686
98 Ga0466722_129704 3300042609 Bacteria 1187
99 AustNasuHG_c1025276 3300000089 Bacteria 1867
100 AustNasuHG_c1062326 3300000089 Bacteria 715
101 JGI24695J34938_10000139 3300002450 Bacteria 65941
102 JGI24695J34938_10300532 3300002450 Bacteria 693
103 Ga0466702_131781 3300042635 Unclassified 1326
104 Ga0123356_10011644 3300010049 Bacteria 8566
105 Ga0123356_10020998 3300010049 Bacteria 6176
106 Ga0123356_11429822 3300010049 Bacteria 851
107 Ga0123356_11804093 3300010049 Bacteria 760
108 Ga0466718_027524 3300042617 Bacteria 6931
109 Ga0466718_091341 3300042617 Bacteria 6874
110 Ga0466718_107693 3300042617 Bacteria 1771
111 Ga0466699_337164 3300042597 Bacteria 4272
112 Ga0466720_008542 3300042607 Bacteria 40016
113 Ga0466722_148307 3300042609 Bacteria 14415
114 Ga0466698_193877 3300042610 Bacteria 6301
115 JGI24698J34947_10029557 3300002449 Bacteria 2894
116 JGI24698J34947_10063453 3300002449 Bacteria 1810
117 JGI24695J34938_10003575 3300002450 Bacteria 10710
118 JGI24695J34938_10032174 3300002450 Bacteria 2426
119 Ga0072940_1159178 3300005200 Bacteria 1352
120 Ga0466732_008974 3300042656 Bacteria 2226
121 Ga0466731_105684 3300042622 Bacteria 9404
122 Ga0466702_040302 3300042635 Unclassified 2177
123 Ga0466702_070573 3300042635 Bacteria 1624
124 Ga0123356_10001386 3300010049 Bacteria 26875
125 Ga0123356_10156528 3300010049 Bacteria 2270
126 Ga0466712_317612 3300042614 Bacteria 15050
127 Ga0466718_078886 3300042617 Bacteria 4971
128 Ga0264413_112885 3300024493 Bacteria 1586
129 Ga0264413_135444 3300024493 Bacteria 8551
130 Ga0415639_060857 3300038395 Bacteria 6958
131 Ga0456237_0000739 3300041968 Bacteria 5043
132 Ga0466692_178154 3300042591 Bacteria 3203
133 Ga0466699_063466 3300042597 Unclassified 2061
134 Ga0466720_014621 3300042607 Bacteria 102324
135 Ga0466721_256306 3300042608 Bacteria 1308
136 AustNasuHG_c1006015 3300000089 Bacteria 4336
137 JGI24698J34947_10021443 3300002449 Bacteria 3474
138 JGI24695J34938_10030990 3300002450 Bacteria 2486
139 Ga0072940_1023360 3300005200 Bacteria 34349
140 Ga0072941_1198974 3300005201 Bacteria 1416

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_008974 Ga0466732_008974_778_1080 100
2 3300000089 AustNasuHG_c1006015 AustNasuHG_10060154 101
3 3300042597 Ga0466699_425188 Ga0466699_425188_87808_88113 101
4 3300000089 AustNasuHG_c1000705 AustNasuHG_100070510 102
5 3300000089 AustNasuHG_c1018721 AustNasuHG_10187212 102
6 3300000089 AustNasuHG_c1062326 AustNasuHG_10623261 102
7 3300024493 Ga0264413_135444 Ga0264413_1354447 102
8 3300042597 Ga0466699_159306 Ga0466699_159306_247_555 102
9 3300042597 Ga0466699_337164 Ga0466699_337164_2143_2451 102
10 3300042607 Ga0466720_008542 Ga0466720_008542_28097_28405 102
11 3300042607 Ga0466720_014621 Ga0466720_014621_22765_23073 102
12 3300042617 Ga0466718_078022 Ga0466718_078022_1862_2170 102
13 3300042656 Ga0466732_429868 Ga0466732_429868_330_638 102
14 iso_pr_bacteria 2819992462 2819994519 102
15 iso_pr_bacteria 2820020240 2820020956 102
16 3300002450 JGI24695J34938_10031881 JGI24695J34938_100318812 103
17 3300005201 Ga0072941_1045063 Ga0072941_10450633 103
18 3300038395 Ga0415639_166680 Ga0415639_166680_602_913 103
19 3300042591 Ga0466692_087331 Ga0466692_087331_1013_1324 103
20 3300042597 Ga0466699_186379 Ga0466699_186379_217_528 103
21 iso_pr_bacteria 2781125692 2781430741 103
22 3300038395 Ga0415639_060857 Ga0415639_060857_5226_5540 104
23 3300042591 Ga0466692_081109 Ga0466692_081109_452_766 104
24 3300042591 Ga0466692_082614 Ga0466692_082614_1968_2282 104
25 3300042591 Ga0466692_178154 Ga0466692_178154_2092_2406 104
26 3300042597 Ga0466699_063466 Ga0466699_063466_230_544 104
27 3300042614 Ga0466712_050950 Ga0466712_050950_1328_1642 104
28 3300000089 AustNasuHG_c1082925 AustNasuHG_10829252 105
29 3300010167 Ga0123353_10684888 Ga0123353_106848884 105
30 3300042594 Ga0466694_020203 Ga0466694_020203_2153_2470 105
31 3300042614 Ga0466712_064105 Ga0466712_064105_15139_15456 105
32 3300042617 Ga0466718_025713 Ga0466718_025713_4817_5134 105
33 3300042617 Ga0466718_143385 Ga0466718_143385_4708_5025 105
34 3300042622 Ga0466731_186790 Ga0466731_186790_4803_5120 105
35 3300042635 Ga0466702_004209 Ga0466702_004209_2615_2932 105
36 3300042635 Ga0466702_040302 Ga0466702_040302_1373_1690 105
37 3300042635 Ga0466702_131781 Ga0466702_131781_121_438 105
38 iso_pr_bacteria 2781125657 2781324020 105
39 3300002449 JGI24698J34947_10021443 JGI24698J34947_100214432 106
40 3300002449 JGI24698J34947_10063453 JGI24698J34947_100634534 106
41 3300002450 JGI24695J34938_10000139 JGI24695J34938_100001394 106
42 3300005201 Ga0072941_1036612 Ga0072941_10366122 106
43 3300010049 Ga0123356_10001386 Ga0123356_1000138616 106
44 3300010049 Ga0123356_11429822 Ga0123356_114298222 106
45 3300024493 Ga0264413_112886 Ga0264413_1128862 106
46 3300041968 Ga0456237_0000739 Ga0456237_0000739_2892_3212 106
47 3300042591 Ga0466692_110321 Ga0466692_110321_325_645 106
48 3300042607 Ga0466720_226106 Ga0466720_226106_540_860 106
49 3300042609 Ga0466722_032167 Ga0466722_032167_492_812 106
50 3300042609 Ga0466722_129704 Ga0466722_129704_16_336 106
51 3300042609 Ga0466722_262071 Ga0466722_262071_3573_3893 106
52 3300042610 Ga0466698_398352 Ga0466698_398352_2260_2580 106
53 3300042617 Ga0466718_040204 Ga0466718_040204_8890_9210 106
54 3300042617 Ga0466718_091341 Ga0466718_091341_2685_3005 106
55 3300042635 Ga0466702_070573 Ga0466702_070573_627_947 106
56 iso_pr_bacteria 2781125636 2781280184 106
57 iso_pr_bacteria 2781125646 2781300931 106
58 3300000089 AustNasuHG_c1025276 AustNasuHG_10252762 107
59 3300001880 FAAS_10001006 FAAS_100010063 107
60 3300002450 JGI24695J34938_10000112 JGI24695J34938_1000011224 107
61 3300002450 JGI24695J34938_10000553 JGI24695J34938_1000055329 107
62 3300002450 JGI24695J34938_10000947 JGI24695J34938_1000094718 107
63 3300005200 Ga0072940_1159178 Ga0072940_11591783 107
64 3300010049 Ga0123356_10020998 Ga0123356_100209987 107
65 3300010049 Ga0123356_10107073 Ga0123356_101070732 107
66 3300010049 Ga0123356_10156528 Ga0123356_101565282 107
67 3300024493 Ga0264413_112885 Ga0264413_1128853 107
68 3300024493 Ga0264413_114977 Ga0264413_11497726 107
69 3300042594 Ga0466694_050416 Ga0466694_050416_4878_5201 107
70 3300042594 Ga0466694_081947 Ga0466694_081947_908_1231 107
71 3300042600 Ga0466700_157299 Ga0466700_157299_335_658 107
72 3300042607 Ga0466720_048686 Ga0466720_048686_4255_4578 107
73 3300042608 Ga0466721_256306 Ga0466721_256306_107_430 107
74 3300042609 Ga0466722_091193 Ga0466722_091193_400_723 107
75 3300042609 Ga0466722_148307 Ga0466722_148307_3966_4289 107
76 3300042609 Ga0466722_246826 Ga0466722_246826_1576_1899 107
77 3300042610 Ga0466698_193877 Ga0466698_193877_524_847 107
78 3300042614 Ga0466712_149807 Ga0466712_149807_447_770 107
79 3300042617 Ga0466718_031808 Ga0466718_031808_5552_5875 107
80 3300042617 Ga0466718_053207 Ga0466718_053207_2680_3003 107
81 3300042617 Ga0466718_149328 Ga0466718_149328_4322_4645 107
82 3300042635 Ga0466702_061015 Ga0466702_061015_5782_6105 107
83 3300042635 Ga0466702_466217 Ga0466702_466217_7745_8068 107
84 iso_pr_bacteria 2781125663 2781338561 107
85 iso_pr_bacteria 2781125665 2781341794 107
86 2228664004 2230969608 2230682978 108
87 3300000089 AustNasuHG_c1000139 AustNasuHG_100013915 108
88 3300002449 JGI24698J34947_10000003 JGI24698J34947_100000036 108
89 3300010049 Ga0123356_10000453 Ga0123356_1000045321 108
90 3300010049 Ga0123356_10011644 Ga0123356_100116443 108
91 3300010049 Ga0123356_10017470 Ga0123356_100174706 108
92 3300010049 Ga0123356_10020064 Ga0123356_100200642 108
93 3300010167 Ga0123353_10138372 Ga0123353_101383726 108
94 3300024493 Ga0264413_105394 Ga0264413_10539411 108
95 3300024493 Ga0264413_105646 Ga0264413_1056469 108
96 3300042594 Ga0466694_044360 Ga0466694_044360_9233_9559 108
97 3300042597 Ga0466699_335402 Ga0466699_335402_185_511 108
98 3300042597 Ga0466699_386670 Ga0466699_386670_367_693 108
99 3300042607 Ga0466720_090063 Ga0466720_090063_1435_1761 108
100 3300042614 Ga0466712_112470 Ga0466712_112470_5445_5771 108
101 3300042614 Ga0466712_317612 Ga0466712_317612_8482_8808 108
102 3300042617 Ga0466718_006444 Ga0466718_006444_39941_40267 108
103 3300042617 Ga0466718_013194 Ga0466718_013194_157_483 108
104 3300042617 Ga0466718_027524 Ga0466718_027524_5624_5950 108
105 3300042617 Ga0466718_032195 Ga0466718_032195_5054_5380 108
106 3300042617 Ga0466718_078886 Ga0466718_078886_259_585 108
107 3300042617 Ga0466718_165921 Ga0466718_165921_2520_2846 108
108 3300042622 Ga0466731_105684 Ga0466731_105684_399_725 108
109 3300042635 Ga0466702_281606 Ga0466702_281606_660_986 108
110 3300042656 Ga0466732_008846 Ga0466732_008846_12421_12747 108
111 3300000089 AustNasuHG_c1004102 AustNasuHG_10041021 109
112 3300002449 JGI24698J34947_10000241 JGI24698J34947_1000024112 109
113 3300038395 Ga0415639_067896 Ga0415639_067896_2149_2478 109
114 3300042592 Ga0466693_253926 Ga0466693_253926_3655_3984 109
115 3300042594 Ga0466694_363261 Ga0466694_363261_1083_1412 109
116 3300042595 Ga0466695_357140 Ga0466695_357140_22100_22429 109
117 3300042617 Ga0466718_047268 Ga0466718_047268_2878_3207 109
118 3300042625 Ga0466730_017903 Ga0466730_017903_839_1168 109
119 iso_pr_bacteria 2781125642 2781292144 109
120 3300002450 JGI24695J34938_10001156 JGI24695J34938_1000115610 110
121 3300002450 JGI24695J34938_10001512 JGI24695J34938_100015126 110
122 3300002450 JGI24695J34938_10002792 JGI24695J34938_1000279213 110
123 3300002450 JGI24695J34938_10003362 JGI24695J34938_100033626 110
124 3300002450 JGI24695J34938_10003575 JGI24695J34938_100035757 110
125 3300002450 JGI24695J34938_10032174 JGI24695J34938_100321742 110
126 3300002450 JGI24695J34938_10049727 JGI24695J34938_100497271 110
127 3300002450 JGI24695J34938_10058596 JGI24695J34938_100585962 110
128 3300002450 JGI24695J34938_10077805 JGI24695J34938_100778052 110
129 3300002450 JGI24695J34938_10300532 JGI24695J34938_103005322 110
130 3300010167 Ga0123353_10130242 Ga0123353_101302421 110
131 3300042592 Ga0466693_316245 Ga0466693_316245_4835_5167 110
132 3300042622 Ga0466731_140819 Ga0466731_140819_788_1120 110
133 3300002450 JGI24695J34938_10030990 JGI24695J34938_100309902 111
134 3300042614 Ga0466712_056613 Ga0466712_056613_7297_7632 111
135 3300002449 JGI24698J34947_10006121 JGI24698J34947_100061215 112
136 3300002449 JGI24698J34947_10066562 JGI24698J34947_100665624 112
137 3300002450 JGI24695J34938_10003321 JGI24695J34938_100033218 112
138 3300005200 Ga0072940_1023360 Ga0072940_102336028 112
139 3300010049 Ga0123356_11804093 Ga0123356_118040932 112
140 3300042614 Ga0466712_314821 Ga0466712_314821_5297_5635 112
141 3300005201 Ga0072941_1032758 Ga0072941_103275811 113
142 3300005201 Ga0072941_1198974 Ga0072941_11989742 113
143 3300042614 Ga0466712_175957 Ga0466712_175957_4477_4818 113
144 3300002449 JGI24698J34947_10029557 JGI24698J34947_100295572 114
145 3300042622 Ga0466731_146462 Ga0466731_146462_801_1151 116
146 3300042622 Ga0466731_334782 Ga0466731_334782_5492_5845 117
147 3300001880 FAAS_10468750 FAAS_104687501 118
148 3300042617 Ga0466718_107693 Ga0466718_107693_1191_1547 118
149 3300024493 Ga0264413_111305 Ga0264413_1113057 125

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 24 112 0.99
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 18 112 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.68 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.