Protein Family IF04164

Metagenome Isolate
138 Members
41 Samples
134 Scaffolds
151.96 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_106339|Ga0264413_1063392
Length
144 aa
Sequence
MKILVDADSCPRAARELALRCSGRRRIQVVFAANRPMPGISGENVIMEICPPGENSADDRLVELAAAGDLAKRLLEKDVIVIDDRGRLFTLDNINELLSLRNFTVGLAENGLGIERTANYGKKELKAFADALDRQITKIINNGS

📊 Sample Types

Isolate 2.9%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 28.9%
Unclassified 13.2%
Rhinotermitidae 5.3%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
8 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
9 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
10 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
22 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466691_010662 3300042593 Bacteria 3847
2 Ga0466731_087665 3300042622 Bacteria 1295
3 Ga0466705_411325 3300042612 Bacteria 6453
4 Ga0466722_008955 3300042609 Bacteria 11922
5 JGI24698J34947_10001789 3300002449 Bacteria 11464
6 JGI24698J34947_10167589 3300002449 Bacteria 893
7 JGI24695J34938_10011742 3300002450 Bacteria 4699
8 JGI24695J34938_10424246 3300002450 Bacteria 597
9 Ga0074263_103175 3300005485 Bacteria 2831
10 Ga0466705_049931 3300042612 Bacteria 17901
11 Ga0123356_10042658 3300010049 Bacteria 4224
12 Ga0264413_125284 3300024493 Unclassified 8047
13 Ga0466694_178677 3300042594 Bacteria 2089
14 Ga0466699_134662 3300042597 Bacteria 7108
15 Ga0466699_315238 3300042597 Bacteria 5256
16 Ga0466727_345077 3300042655 Bacteria 5699
17 Ga0466712_052003 3300042614 Bacteria 5345
18 Ga0466712_302776 3300042614 Bacteria 3124
19 Ga0466718_064859 3300042617 Bacteria 21008
20 Ga0466728_194272 3300042620 Bacteria 1343
21 Ga0466714_036867 3300042603 Bacteria 1804
22 Ga0466716_392321 3300042605 Bacteria 5416
23 Ga0466720_042088 3300042607 Bacteria 4122
24 FAAS_10252355 3300001880 Bacteria 563
25 JGI24698J34947_10015008 3300002449 Bacteria 4218
26 Ga0072941_1015842 3300005201 Bacteria 3211
27 Ga0072941_1027538 3300005201 Bacteria 3462
28 Ga0072941_1053271 3300005201 Bacteria 5687
29 Ga0466732_052426 3300042656 Bacteria 4206
30 Ga0123353_10541696 3300010167 Bacteria 1682
31 Ga0466691_001852 3300042593 Bacteria 4316
32 Ga0466704_167337 3300042643 Bacteria 117281
33 Ga0466704_233337 3300042643 Bacteria 4157
34 Ga0466712_244775 3300042614 Unclassified 1092
35 Ga0466715_559922 3300042616 Bacteria 5168
36 Ga0466700_141504 3300042600 Bacteria 2119
37 Ga0466719_518056 3300042606 Bacteria 1717
38 Ga0466720_016498 3300042607 Unclassified 2089
39 Ga0466722_189659 3300042609 Bacteria 4545
40 JGI24698J34947_10008872 3300002449 Bacteria 5519
41 JGI24698J34947_10022401 3300002449 Bacteria 3389
42 JGI24695J34938_10005448 3300002450 Bacteria 7929
43 JGI24695J34938_10019317 3300002450 Bacteria 3381
44 Ga0072940_1004918 3300005200 Bacteria 32026
45 Ga0072940_1020928 3300005200 Bacteria 3472
46 Ga0072941_1022982 3300005201 Bacteria 707
47 Ga0074263_114727 3300005485 Bacteria 2800
48 Ga0466705_068536 3300042612 Bacteria 3719
49 Ga0264413_118613 3300024493 Bacteria 3364
50 Ga0466690_311327 3300042590 Bacteria 4389
51 Ga0466694_310178 3300042594 Bacteria 1048
52 Ga0466694_346750 3300042594 Bacteria 13755
53 Ga0466699_013984 3300042597 Bacteria 2716
54 Ga0466699_066384 3300042597 Bacteria 1336
55 Ga0466699_068820 3300042597 Bacteria 1256
56 Ga0466699_150332 3300042597 Bacteria 9436
57 Ga0466699_245560 3300042597 Bacteria 1356
58 Ga0466703_130931 3300042636 Bacteria 4349
59 Ga0466708_108618 3300042652 Bacteria 24572
60 Ga0466707_329942 3300042601 Bacteria 2140
61 Ga0466722_121453 3300042609 Bacteria 2817
62 Ga0466722_224732 3300042609 Bacteria 9570
63 Ga0466698_242907 3300042610 Bacteria 1253
64 AustNasuHG_c1000171 3300000089 Bacteria 21002
65 FAAS_10305196 3300001880 Bacteria 591
66 JGI24698J34947_10019462 3300002449 Bacteria 3661
67 Ga0072940_1000036 3300005200 Bacteria 5930
68 Ga0072940_1009319 3300005200 Bacteria 6757
69 Ga0072941_1184466 3300005201 Bacteria 2299
70 Ga0074263_105094 3300005485 Bacteria 1667
71 Ga0466705_125277 3300042612 Bacteria 2524
72 Ga0123355_10030428 3300009826 Bacteria 8748
73 Ga0264413_135542 3300024493 Bacteria 1289
74 Ga0466690_382246 3300042590 Bacteria 5664
75 Ga0466694_192495 3300042594 Bacteria 1534
76 Ga0466699_066319 3300042597 Bacteria 2314
77 Ga0466712_021690 3300042614 Bacteria 45968
78 Ga0466711_099285 3300042615 Bacteria 4705
79 Ga0466701_032668 3300042598 Bacteria 1190
80 Ga0466720_110476 3300042607 Bacteria 1485
81 Ga0466720_177676 3300042607 Bacteria 91443
82 Ga0466720_194796 3300042607 Bacteria 5719
83 JGI24698J34947_10003186 3300002449 Bacteria 8890
84 JGI24698J34947_10027076 3300002449 Bacteria 3043
85 JGI24698J34947_10162944 3300002449 Bacteria 911
86 Ga0072940_1216967 3300005200 Bacteria 1107
87 Ga0123353_10964020 3300010167 Bacteria 1152
88 Ga0466699_042681 3300042597 Bacteria 2652
89 Ga0466699_127057 3300042597 Unclassified 1168
90 Ga0466699_136625 3300042597 Bacteria 7726
91 Ga0466699_247310 3300042597 Bacteria 2096
92 Ga0466699_286994 3300042597 Unclassified 2496
93 Ga0466708_013823 3300042652 Bacteria 15268
94 Ga0466728_144243 3300042620 Bacteria 10187
95 Ga0466700_287004 3300042600 Bacteria 1496
96 Ga0466716_422590 3300042605 Bacteria 2128
97 Ga0466720_042945 3300042607 Bacteria 11120
98 AustNasuHG_c1009164 3300000089 Bacteria 3483
99 JGI24698J34947_10014804 3300002449 Bacteria 4248
100 JGI24695J34938_10006745 3300002450 Bacteria 6832
101 JGI24695J34938_10011898 3300002450 Bacteria 4650
102 Ga0072940_1031463 3300005200 Bacteria 2802
103 Ga0072941_1012365 3300005201 Bacteria 14347
104 Ga0072941_1210121 3300005201 Bacteria 2074
105 Ga0123353_10295515 3300010167 Bacteria 2477
106 Ga0123353_10463965 3300010167 Bacteria 1860
107 Ga0264413_106339 3300024493 Bacteria 1045
108 Ga0264413_110293 3300024493 Bacteria 13666
109 Ga0466692_002352 3300042591 Bacteria 7304
110 Ga0466692_042581 3300042591 Bacteria 2098
111 Ga0466699_056782 3300042597 Bacteria 8294
112 Ga0466699_301575 3300042597 Bacteria 8866
113 Ga0466699_312868 3300042597 Bacteria 3400
114 Ga0466727_000110 3300042655 Bacteria 11699
115 Ga0466712_185040 3300042614 Unclassified 3436
116 Ga0466712_275746 3300042614 Bacteria 1126
117 Ga0466720_008103 3300042607 Unclassified 2441
118 Ga0466720_065866 3300042607 Bacteria 1708
119 JGI24698J34947_10027483 3300002449 Bacteria 3018
120 JGI24698J34947_10083168 3300002449 Bacteria 1494
121 JGI24695J34938_10010130 3300002450 Bacteria 5191
122 JGI24695J34938_10025501 3300002450 Bacteria 2825
123 Ga0072941_1140061 3300005201 Unclassified 2269
124 Ga0123356_13179677 3300010049 Bacteria 572
125 Ga0466694_209082 3300042594 Bacteria 7012
126 Ga0466699_051298 3300042597 Bacteria 7531
127 Ga0466699_148119 3300042597 Bacteria 7095
128 Ga0466699_395568 3300042597 Bacteria 1549
129 Ga0466704_108854 3300042643 Bacteria 24907
130 Ga0466712_162820 3300042614 Bacteria 9684
131 Ga0466712_228312 3300042614 Bacteria 11861
132 Ga0466718_168376 3300042617 Bacteria 4320
133 JGI24698J34947_10000501 3300002449 Bacteria 18414
134 Ga0072940_1000040 3300005200 Bacteria 8281

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_185040 Ga0466712_185040_890_1339 136
2 3300042614 Ga0466712_244775 Ga0466712_244775_557_1006 136
3 3300042614 Ga0466712_275746 Ga0466712_275746_599_1051 137
4 3300002449 JGI24698J34947_10003186 JGI24698J34947_100031865 138
5 3300002449 JGI24698J34947_10015008 JGI24698J34947_100150083 138
6 3300002449 JGI24698J34947_10027076 JGI24698J34947_100270764 138
7 3300002449 JGI24698J34947_10027483 JGI24698J34947_100274833 138
8 3300002449 JGI24698J34947_10008872 JGI24698J34947_100088725 140
9 3300024493 Ga0264413_106339 Ga0264413_1063392 144
10 3300042590 Ga0466690_382246 Ga0466690_382246_457_900 147
11 3300005200 Ga0072940_1020928 Ga0072940_10209285 148
12 3300010167 Ga0123353_10463965 Ga0123353_104639652 148
13 3300042607 Ga0466720_008103 Ga0466720_008103_608_1054 148
14 3300042607 Ga0466720_065866 Ga0466720_065866_965_1411 148
15 3300042616 Ga0466715_559922 Ga0466715_559922_4438_4884 148
16 3300042617 Ga0466718_064859 Ga0466718_064859_20329_20775 148
17 iso_pr_bacteria 2781125633 2781273391 148
18 3300002450 JGI24695J34938_10010130 JGI24695J34938_100101306 149
19 3300005201 Ga0072941_1022982 Ga0072941_10229821 149
20 3300005201 Ga0072941_1027538 Ga0072941_10275381 149
21 3300005201 Ga0072941_1140061 Ga0072941_11400614 149
22 3300005201 Ga0072941_1184466 Ga0072941_11844664 149
23 3300010167 Ga0123353_10295515 Ga0123353_102955153 149
24 3300024493 Ga0264413_125284 Ga0264413_1252843 149
25 3300042597 Ga0466699_013984 Ga0466699_013984_2246_2695 149
26 3300042597 Ga0466699_051298 Ga0466699_051298_185_634 149
27 3300042597 Ga0466699_056782 Ga0466699_056782_3057_3506 149
28 3300042597 Ga0466699_066319 Ga0466699_066319_1067_1516 149
29 3300042597 Ga0466699_066384 Ga0466699_066384_365_814 149
30 3300042597 Ga0466699_068820 Ga0466699_068820_127_576 149
31 3300042597 Ga0466699_127057 Ga0466699_127057_98_547 149
32 3300042597 Ga0466699_136625 Ga0466699_136625_4729_5178 149
33 3300042597 Ga0466699_148119 Ga0466699_148119_3168_3617 149
34 3300042597 Ga0466699_150332 Ga0466699_150332_5045_5494 149
35 3300042597 Ga0466699_245560 Ga0466699_245560_764_1213 149
36 3300042597 Ga0466699_286994 Ga0466699_286994_445_894 149
37 3300042600 Ga0466700_287004 Ga0466700_287004_63_512 149
38 3300042609 Ga0466722_224732 Ga0466722_224732_7373_7822 149
39 3300042614 Ga0466712_021690 Ga0466712_021690_16495_16944 149
40 3300042614 Ga0466712_052003 Ga0466712_052003_1039_1488 149
41 3300042614 Ga0466712_228312 Ga0466712_228312_5902_6351 149
42 3300042614 Ga0466712_302776 Ga0466712_302776_992_1441 149
43 3300042652 Ga0466708_108618 Ga0466708_108618_12564_13013 149
44 3300002449 JGI24698J34947_10000501 JGI24698J34947_1000050114 150
45 3300002449 JGI24698J34947_10001789 JGI24698J34947_1000178911 150
46 3300002449 JGI24698J34947_10014804 JGI24698J34947_100148043 150
47 3300002449 JGI24698J34947_10019462 JGI24698J34947_100194624 150
48 3300002449 JGI24698J34947_10022401 JGI24698J34947_100224013 150
49 3300002449 JGI24698J34947_10083168 JGI24698J34947_100831682 150
50 3300002449 JGI24698J34947_10162944 JGI24698J34947_101629442 150
51 3300002449 JGI24698J34947_10167589 JGI24698J34947_101675891 150
52 3300005201 Ga0072941_1012365 Ga0072941_101236510 150
53 3300005201 Ga0072941_1015842 Ga0072941_10158422 150
54 3300005201 Ga0072941_1053271 Ga0072941_10532713 150
55 3300005485 Ga0074263_103175 Ga0074263_1031753 150
56 3300024493 Ga0264413_110293 Ga0264413_11029314 150
57 3300024493 Ga0264413_118613 Ga0264413_1186133 150
58 3300042591 Ga0466692_002352 Ga0466692_002352_5779_6231 150
59 3300042593 Ga0466691_001852 Ga0466691_001852_3789_4241 150
60 3300042594 Ga0466694_192495 Ga0466694_192495_113_565 150
61 3300042594 Ga0466694_346750 Ga0466694_346750_2801_3253 150
62 3300042597 Ga0466699_301575 Ga0466699_301575_7255_7707 150
63 3300042597 Ga0466699_315238 Ga0466699_315238_2549_3001 150
64 3300042606 Ga0466719_518056 Ga0466719_518056_978_1430 150
65 3300042607 Ga0466720_016498 Ga0466720_016498_1278_1730 150
66 3300042607 Ga0466720_042088 Ga0466720_042088_3458_3910 150
67 3300042607 Ga0466720_042945 Ga0466720_042945_2567_3019 150
68 3300042607 Ga0466720_194796 Ga0466720_194796_2932_3384 150
69 3300042609 Ga0466722_008955 Ga0466722_008955_5043_5495 150
70 3300042612 Ga0466705_049931 Ga0466705_049931_138_590 150
71 3300042612 Ga0466705_411325 Ga0466705_411325_2468_2920 150
72 3300042622 Ga0466731_087665 Ga0466731_087665_493_945 150
73 3300042636 Ga0466703_130931 Ga0466703_130931_1009_1461 150
74 3300042643 Ga0466704_167337 Ga0466704_167337_49973_50425 150
75 iso_pr_bacteria 2781125640 2781288857 150
76 3300000089 AustNasuHG_c1000171 AustNasuHG_100017119 151
77 3300002450 JGI24695J34938_10006745 JGI24695J34938_1000674510 151
78 3300002450 JGI24695J34938_10011742 JGI24695J34938_100117427 151
79 3300002450 JGI24695J34938_10019317 JGI24695J34938_100193171 151
80 3300005200 Ga0072940_1004918 Ga0072940_100491828 151
81 3300005485 Ga0074263_114727 Ga0074263_1147273 151
82 3300010049 Ga0123356_10042658 Ga0123356_100426584 151
83 3300042601 Ga0466707_329942 Ga0466707_329942_1078_1533 151
84 3300042610 Ga0466698_242907 Ga0466698_242907_683_1138 151
85 3300042617 Ga0466718_168376 Ga0466718_168376_3829_4284 151
86 3300042643 Ga0466704_233337 Ga0466704_233337_1163_1618 151
87 3300002450 JGI24695J34938_10424246 JGI24695J34938_104242461 152
88 3300005200 Ga0072940_1009319 Ga0072940_10093196 152
89 3300005200 Ga0072940_1031463 Ga0072940_10314631 152
90 3300005200 Ga0072940_1216967 Ga0072940_12169672 152
91 3300010049 Ga0123356_13179677 Ga0123356_131796771 152
92 3300010167 Ga0123353_10964020 Ga0123353_109640202 152
93 3300042597 Ga0466699_042681 Ga0466699_042681_1977_2435 152
94 3300042597 Ga0466699_312868 Ga0466699_312868_440_898 152
95 3300042600 Ga0466700_141504 Ga0466700_141504_808_1266 152
96 3300042609 Ga0466722_121453 Ga0466722_121453_2315_2773 152
97 3300042609 Ga0466722_189659 Ga0466722_189659_3760_4218 152
98 3300001880 FAAS_10305196 FAAS_103051961 154
99 3300002450 JGI24695J34938_10011898 JGI24695J34938_100118986 154
100 3300005200 Ga0072940_1000036 Ga0072940_100003613 154
101 3300005201 Ga0072941_1210121 Ga0072941_12101213 154
102 3300042594 Ga0466694_209082 Ga0466694_209082_1592_2056 154
103 3300042615 Ga0466711_099285 Ga0466711_099285_2090_2554 154
104 3300000089 AustNasuHG_c1009164 AustNasuHG_10091642 155
105 3300009826 Ga0123355_10030428 Ga0123355_100304288 155
106 3300042603 Ga0466714_036867 Ga0466714_036867_809_1276 155
107 3300042591 Ga0466692_042581 Ga0466692_042581_520_990 156
108 3300042612 Ga0466705_068536 Ga0466705_068536_3169_3639 156
109 3300042612 Ga0466705_125277 Ga0466705_125277_1518_1988 156
110 3300042614 Ga0466712_162820 Ga0466712_162820_183_653 156
111 3300042643 Ga0466704_108854 Ga0466704_108854_3671_4141 156
112 3300042655 Ga0466727_345077 Ga0466727_345077_1798_2268 156
113 3300001880 FAAS_10252355 FAAS_102523551 157
114 3300010167 Ga0123353_10541696 Ga0123353_105416962 157
115 3300042597 Ga0466699_134662 Ga0466699_134662_3814_4287 157
116 3300042605 Ga0466716_392321 Ga0466716_392321_4440_4913 157
117 3300002450 JGI24695J34938_10005448 JGI24695J34938_100054486 158
118 3300042620 Ga0466728_144243 Ga0466728_144243_3446_3922 158
119 iso_pr_bacteria 2781125682 2781408703 158
120 3300042597 Ga0466699_247310 Ga0466699_247310_423_902 159
121 3300042597 Ga0466699_395568 Ga0466699_395568_294_773 159
122 3300042607 Ga0466720_110476 Ga0466720_110476_941_1420 159
123 3300042620 Ga0466728_194272 Ga0466728_194272_392_871 159
124 3300042656 Ga0466732_052426 Ga0466732_052426_1465_1944 159
125 3300024493 Ga0264413_135542 Ga0264413_1355422 160
126 3300042607 Ga0466720_177676 Ga0466720_177676_63065_63550 161
127 3300042652 Ga0466708_013823 Ga0466708_013823_4394_4879 161
128 iso_pr_bacteria 2772190978 2773731451 161
129 3300042594 Ga0466694_178677 Ga0466694_178677_1172_1660 162
130 3300042605 Ga0466716_422590 Ga0466716_422590_1051_1539 162
131 3300042655 Ga0466727_000110 Ga0466727_000110_635_1126 163
132 3300002450 JGI24695J34938_10025501 JGI24695J34938_100255014 164
133 3300042598 Ga0466701_032668 Ga0466701_032668_558_1052 164
134 3300042593 Ga0466691_010662 Ga0466691_010662_3035_3532 165
135 3300042590 Ga0466690_311327 Ga0466690_311327_1648_2157 169
136 3300042594 Ga0466694_310178 Ga0466694_310178_321_833 170
137 3300005200 Ga0072940_1000040 Ga0072940_10000406 173
138 3300005485 Ga0074263_105094 Ga0074263_1050941 179

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02639 DUF188 Uncharacterized BCR, YaiI/YqxD family COG1671 19 138 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.