Protein Family IF04163

Metagenome Isolate
137 Members
47 Samples
131 Scaffolds
293.15 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_106251|Ga0264413_1062514
Length
340 aa
Sequence
LPLRGNNVFTLDTQTAGAHFFAIGYQHPPGQCIFQIKTVLLLILFXSNASDGDFSPAQLIREAQKRGITVLALTDHDTLGGLKGAQGEANAVGVRFIPGIEISINWTKTAGASGLGPGGEMHLLGLGIKTPSPAFLAAIAELSRRREERNREILDNMNALGIEASWDDILAETGLSLTYPVGASVSSLSIGRPHFASFLVKRKIVRNKDQAFARYLKPGKPLFVPKAGLPFGQAAALIRESGGIPVLAHPMSLYVAWGCLPDLVKALKNQGLMGIEAWHPIAKARACHRLEELGRGLGLYITEGSDFHGTTRVGRYLGISNKGREISESVLEAIPELFYP

πŸ“Š Sample Types

Isolate 3.6%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 42.2%
Kalotermitidae 28.9%
Unclassified 17.8%
Rhinotermitidae 6.7%
Termopsidae 4.4%

🌳 Taxonomy

Archaea 1
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
7 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
8 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
31 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
37 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_297853 3300042636 Bacteria 2680
2 JGI24698J34947_10000602 3300002449 Bacteria 17226
3 Ga0466718_107560 3300042617 Bacteria 3588
4 Ga0466694_138924 3300042594 Bacteria 3789
5 Ga0466699_023711 3300042597 Bacteria 1980
6 Ga0466699_217622 3300042597 Bacteria 7492
7 Ga0466720_073893 3300042607 Bacteria 3287
8 Ga0466709_245705 3300042648 Bacteria 10723
9 JGI24698J34947_10019593 3300002449 Unclassified 3647
10 JGI24698J34947_10027377 3300002449 Bacteria 3025
11 JGI24698J34947_10079729 3300002449 Bacteria 1541
12 Ga0466712_007308 3300042614 Bacteria 17090
13 Ga0466712_291404 3300042614 Unclassified 1811
14 Ga0466715_080388 3300042616 Bacteria 3423
15 Ga0466715_586083 3300042616 Bacteria 3791
16 Ga0466718_081859 3300042617 Bacteria 1601
17 Ga0466690_337054 3300042590 Bacteria 5097
18 Ga0466716_288812 3300042605 Bacteria 4326
19 Ga0466720_115208 3300042607 Bacteria 9027
20 Ga0466720_126151 3300042607 Unclassified 2534
21 Ga0466720_166905 3300042607 Unclassified 3168
22 Ga0466732_271304 3300042656 Bacteria 13044
23 JGI24698J34947_10052222 3300002449 Bacteria 2052
24 JGI24695J34938_10040845 3300002450 Bacteria 2086
25 JGI24699J35502_11082207 3300002509 Unclassified 1992
26 JGI24699J35502_11131451 3300002509 Bacteria 5718
27 Ga0072941_1055817 3300005201 Bacteria 5068
28 Ga0466712_227086 3300042614 Bacteria 3198
29 Ga0466723_012739 3300042618 Bacteria 44053
30 Ga0466723_136808 3300042618 Bacteria 5360
31 Ga0466723_231664 3300042618 Bacteria 2506
32 Ga0466699_374924 3300042597 Bacteria 1166
33 Ga0466700_088653 3300042600 Bacteria 1998
34 Ga0466719_502114 3300042606 Bacteria 3507
35 Ga0466720_037955 3300042607 Bacteria 4880
36 Ga0466705_240811 3300042612 Bacteria 25843
37 Ga0466732_302524 3300042656 Bacteria 1301
38 Ga0466709_373657 3300042648 Bacteria 2445
39 Ga0466708_224073 3300042652 Bacteria 40955
40 JGI24698J34947_10094254 3300002449 Unclassified 1364
41 JGI24695J34938_10032226 3300002450 Bacteria 2423
42 Ga0072941_1036489 3300005201 Bacteria 5954
43 Ga0123356_10317545 3300010049 Bacteria 1670
44 Ga0466712_059558 3300042614 Bacteria 4833
45 Ga0466712_091644 3300042614 Bacteria 12686
46 Ga0466715_074677 3300042616 Bacteria 46767
47 Ga0466718_036583 3300042617 Bacteria 24017
48 Ga0264413_106251 3300024493 Bacteria 6350
49 Ga0264413_129783 3300024493 Bacteria 3246
50 Ga0466690_106973 3300042590 Bacteria 3250
51 Ga0466692_080945 3300042591 Bacteria 1654
52 Ga0466693_416307 3300042592 Bacteria 2597
53 Ga0466691_052389 3300042593 Bacteria 5135
54 Ga0466694_032891 3300042594 Bacteria 2809
55 Ga0466707_152939 3300042601 Bacteria 8076
56 Ga0466714_017715 3300042603 Bacteria 1658
57 Ga0466720_093590 3300042607 Bacteria 1375
58 Ga0466720_209141 3300042607 Bacteria 5508
59 Ga0466722_003624 3300042609 Bacteria 6344
60 Ga0466722_064257 3300042609 Bacteria 17947
61 Ga0466704_618400 3300042643 Bacteria 25200
62 Ga0072941_1065726 3300005201 Bacteria 2086
63 Ga0466712_068825 3300042614 Bacteria 8346
64 Ga0466712_129347 3300042614 Bacteria 3476
65 Ga0466715_514480 3300042616 Bacteria 23319
66 Ga0466723_342696 3300042618 Bacteria 4674
67 Ga0466726_373788 3300042619 Bacteria 1235
68 Ga0264413_120625 3300024493 Bacteria 1426
69 Ga0466696_479064 3300042596 Bacteria 10807
70 Ga0466699_133028 3300042597 Bacteria 21739
71 Ga0466699_270503 3300042597 Bacteria 1216
72 Ga0466713_044217 3300042602 Bacteria 4145
73 Ga0466720_177676 3300042607 Bacteria 91443
74 Ga0466720_206281 3300042607 Bacteria 2786
75 Ga0466732_259914 3300042656 Bacteria 16987
76 AustNasuHG_c1009702 3300000089 Bacteria 3374
77 JGI24698J34947_10043076 3300002449 Bacteria 2315
78 JGI24698J34947_10054403 3300002449 Bacteria 1999
79 Ga0072940_1010885 3300005200 Bacteria 2408
80 Ga0072941_1012972 3300005201 Bacteria 7473
81 Ga0072941_1037334 3300005201 Bacteria 8402
82 Ga0074263_104438 3300005485 Bacteria 3160
83 Ga0466712_012768 3300042614 Bacteria 2721
84 Ga0466711_233568 3300042615 Bacteria 4096
85 Ga0466715_245760 3300042616 Bacteria 4747
86 Ga0466718_003939 3300042617 Bacteria 3115
87 Ga0466718_091643 3300042617 Bacteria 1233
88 Ga0466723_207720 3300042618 Bacteria 5409
89 Ga0466726_378883 3300042619 Bacteria 1092
90 Ga0264413_116327 3300024493 Bacteria 2056
91 Ga0466694_134099 3300042594 Bacteria 1981
92 Ga0466699_054526 3300042597 Bacteria 3412
93 Ga0466699_437768 3300042597 Bacteria 1347
94 Ga0466720_018396 3300042607 Bacteria 25285
95 Ga0466698_362086 3300042610 Bacteria 4354
96 Ga0466705_293436 3300042612 Bacteria 17863
97 Ga0466729_236729 3300042621 Bacteria 1432
98 Ga0466709_220857 3300042648 Bacteria 13847
99 JGI24698J34947_10009743 3300002449 Bacteria 5268
100 JGI24698J34947_10012965 3300002449 Bacteria 4554
101 JGI24698J34947_10034500 3300002449 Bacteria 2647
102 Ga0123355_10057438 3300009826 Bacteria 6296
103 Ga0123355_10358857 3300009826 Archaea 1922
104 Ga0123356_10001166 3300010049 Bacteria 29061
105 Ga0466712_037680 3300042614 Unclassified 1958
106 Ga0466718_028352 3300042617 Bacteria 18467
107 Ga0466729_195335 3300042621 Bacteria 1047
108 Ga0466692_062464 3300042591 Bacteria 15794
109 Ga0466691_000335 3300042593 Bacteria 15328
110 Ga0466691_224774 3300042593 Bacteria 9308
111 Ga0466699_103691 3300042597 Bacteria 17413
112 Ga0466699_235112 3300042597 Bacteria 5684
113 Ga0466699_396151 3300042597 Bacteria 3418
114 Ga0466720_027066 3300042607 Bacteria 16538
115 Ga0466732_008326 3300042656 Bacteria 1146
116 Ga0466735_142022 3300042624 Bacteria 1440
117 Ga0466704_031252 3300042643 Bacteria 4694
118 JGI24698J34947_10019603 3300002449 Bacteria 3646
119 Ga0068305_10224554 3300005083 Bacteria 17377
120 Ga0072941_1012860 3300005201 Bacteria 7543
121 Ga0072941_1054309 3300005201 Unclassified 12024
122 Ga0466705_411344 3300042612 Bacteria 8082
123 Ga0466712_071887 3300042614 Bacteria 17078
124 Ga0466712_324304 3300042614 Bacteria 24690
125 Ga0466718_010209 3300042617 Bacteria 2425
126 Ga0466718_109414 3300042617 Bacteria 16236
127 Ga0466694_014107 3300042594 Bacteria 2911
128 Ga0466717_011181 3300042604 Bacteria 1820
129 Ga0466720_163349 3300042607 Bacteria 9865
130 Ga0466722_038290 3300042609 Bacteria 10223
131 Ga0466722_210199 3300042609 Bacteria 4460

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1012860 Ga0072941_10128606 257
2 3300005200 Ga0072940_1010885 Ga0072940_10108852 266
3 3300009826 Ga0123355_10358857 Ga0123355_103588571 272
4 3300042607 Ga0466720_018396 Ga0466720_018396_23074_23952 273
5 3300042617 Ga0466718_107560 Ga0466718_107560_2257_3084 275
6 3300042621 Ga0466729_236729 Ga0466729_236729_197_1024 275
7 3300042656 Ga0466732_302524 Ga0466732_302524_19_846 275
8 3300042607 Ga0466720_209141 Ga0466720_209141_4041_4877 278
9 3300042607 Ga0466720_177676 Ga0466720_177676_28281_29120 279
10 3300042607 Ga0466720_115208 Ga0466720_115208_4691_5539 282
11 3300042614 Ga0466712_091644 Ga0466712_091644_426_1316 282
12 3300042618 Ga0466723_231664 Ga0466723_231664_219_1067 282
13 3300042643 Ga0466704_031252 Ga0466704_031252_3144_3992 282
14 3300042656 Ga0466732_008326 Ga0466732_008326_56_904 282
15 3300042601 Ga0466707_152939 Ga0466707_152939_3254_4105 283
16 3300042607 Ga0466720_073893 Ga0466720_073893_1302_2201 283
17 3300042612 Ga0466705_411344 Ga0466705_411344_4056_4907 283
18 3300042615 Ga0466711_233568 Ga0466711_233568_10_861 283
19 3300042621 Ga0466729_195335 Ga0466729_195335_165_1016 283
20 3300002450 JGI24695J34938_10032226 JGI24695J34938_100322262 286
21 3300005201 Ga0072941_1012972 Ga0072941_10129722 286
22 3300042594 Ga0466694_032891 Ga0466694_032891_924_1784 286
23 3300042614 Ga0466712_007308 Ga0466712_007308_6659_7519 286
24 3300042614 Ga0466712_129347 Ga0466712_129347_203_1063 286
25 3300042614 Ga0466712_227086 Ga0466712_227086_2235_3095 286
26 3300002449 JGI24698J34947_10000602 JGI24698J34947_1000060215 287
27 3300002449 JGI24698J34947_10019593 JGI24698J34947_100195932 287
28 3300002509 JGI24699J35502_11082207 JGI24699J35502_110822071 287
29 3300005201 Ga0072941_1037334 Ga0072941_10373342 287
30 3300042603 Ga0466714_017715 Ga0466714_017715_703_1566 287
31 3300042619 Ga0466726_373788 Ga0466726_373788_269_1132 287
32 3300042652 Ga0466708_224073 Ga0466708_224073_36344_37207 287
33 3300024493 Ga0264413_120625 Ga0264413_1206252 288
34 3300042593 Ga0466691_224774 Ga0466691_224774_1281_2147 288
35 3300042597 Ga0466699_437768 Ga0466699_437768_468_1334 288
36 3300042616 Ga0466715_080388 Ga0466715_080388_2332_3198 288
37 iso_pr_bacteria 2781125633 2781272212 288
38 3300042612 Ga0466705_293436 Ga0466705_293436_8586_9455 289
39 3300002449 JGI24698J34947_10027377 JGI24698J34947_100273772 290
40 3300002449 JGI24698J34947_10052222 JGI24698J34947_100522222 290
41 3300005083 Ga0068305_10224554 Ga0068305_1022455413 290
42 3300005201 Ga0072941_1055817 Ga0072941_10558172 290
43 3300042597 Ga0466699_023711 Ga0466699_023711_227_1099 290
44 3300042597 Ga0466699_054526 Ga0466699_054526_1162_2034 290
45 3300042597 Ga0466699_103691 Ga0466699_103691_1086_1958 290
46 3300042597 Ga0466699_133028 Ga0466699_133028_12572_13444 290
47 3300042597 Ga0466699_374924 Ga0466699_374924_182_1054 290
48 3300042597 Ga0466699_396151 Ga0466699_396151_1477_2349 290
49 3300042602 Ga0466713_044217 Ga0466713_044217_1791_2663 290
50 3300042605 Ga0466716_288812 Ga0466716_288812_3092_3964 290
51 3300042607 Ga0466720_163349 Ga0466720_163349_7231_8103 290
52 3300042614 Ga0466712_291404 Ga0466712_291404_376_1248 290
53 3300002449 JGI24698J34947_10019603 JGI24698J34947_100196032 291
54 3300002449 JGI24698J34947_10034500 JGI24698J34947_100345002 291
55 3300009826 Ga0123355_10057438 Ga0123355_100574385 291
56 3300042594 Ga0466694_134099 Ga0466694_134099_290_1165 291
57 3300042604 Ga0466717_011181 Ga0466717_011181_240_1115 291
58 3300042606 Ga0466719_502114 Ga0466719_502114_1932_2807 291
59 3300042618 Ga0466723_136808 Ga0466723_136808_4426_5301 291
60 3300042636 Ga0466703_297853 Ga0466703_297853_626_1501 291
61 iso_pr_bacteria 2781125631 2781268388 291
62 3300005485 Ga0074263_104438 Ga0074263_1044383 292
63 3300010049 Ga0123356_10317545 Ga0123356_103175451 292
64 3300042607 Ga0466720_037955 Ga0466720_037955_2914_3792 292
65 3300042607 Ga0466720_126151 Ga0466720_126151_650_1528 292
66 3300042607 Ga0466720_206281 Ga0466720_206281_1336_2214 292
67 3300042614 Ga0466712_012768 Ga0466712_012768_1452_2330 292
68 3300042614 Ga0466712_037680 Ga0466712_037680_94_972 292
69 3300042614 Ga0466712_071887 Ga0466712_071887_10196_11074 292
70 3300042617 Ga0466718_081859 Ga0466718_081859_140_1045 292
71 3300042648 Ga0466709_220857 Ga0466709_220857_5222_6100 292
72 iso_pr_bacteria 2781125689 2781426056 292
73 3300002449 JGI24698J34947_10012965 JGI24698J34947_100129653 293
74 3300002449 JGI24698J34947_10054403 JGI24698J34947_100544032 293
75 3300002509 JGI24699J35502_11131451 JGI24699J35502_111314516 293
76 3300042596 Ga0466696_479064 Ga0466696_479064_7890_8795 293
77 3300042607 Ga0466720_018396 Ga0466720_018396_9728_10609 293
78 3300042607 Ga0466720_166905 Ga0466720_166905_1331_2212 293
79 3300005201 Ga0072941_1054309 Ga0072941_105430912 294
80 3300042617 Ga0466718_091643 Ga0466718_091643_253_1137 294
81 3300042648 Ga0466709_245705 Ga0466709_245705_2266_3150 294
82 3300042614 Ga0466712_068825 Ga0466712_068825_7258_8145 295
83 3300042614 Ga0466712_324304 Ga0466712_324304_9164_10051 295
84 iso_pr_bacteria 2781125658 2781325145 295
85 3300002449 JGI24698J34947_10094254 JGI24698J34947_100942542 296
86 3300010049 Ga0123356_10001166 Ga0123356_1000116616 296
87 3300042591 Ga0466692_062464 Ga0466692_062464_5848_6738 296
88 3300042592 Ga0466693_416307 Ga0466693_416307_1032_1922 296
89 3300042593 Ga0466691_052389 Ga0466691_052389_250_1140 296
90 3300042600 Ga0466700_088653 Ga0466700_088653_425_1315 296
91 3300042616 Ga0466715_514480 Ga0466715_514480_4687_5577 296
92 3300042616 Ga0466715_586083 Ga0466715_586083_1152_2042 296
93 3300042617 Ga0466718_003939 Ga0466718_003939_771_1661 296
94 3300042617 Ga0466718_010209 Ga0466718_010209_95_985 296
95 3300042619 Ga0466726_378883 Ga0466726_378883_55_945 296
96 3300042624 Ga0466735_142022 Ga0466735_142022_379_1269 296
97 3300042648 Ga0466709_373657 Ga0466709_373657_166_1056 296
98 3300002449 JGI24698J34947_10079729 JGI24698J34947_100797292 297
99 3300042617 Ga0466718_036583 Ga0466718_036583_4438_5331 297
100 iso_pr_bacteria 2781125640 2781287205 297
101 3300005201 Ga0072941_1036489 Ga0072941_10364893 298
102 3300024493 Ga0264413_129783 Ga0264413_1297835 298
103 3300042614 Ga0466712_059558 Ga0466712_059558_2664_3560 298
104 3300000089 AustNasuHG_c1009702 AustNasuHG_10097022 299
105 3300002449 JGI24698J34947_10009743 JGI24698J34947_100097432 299
106 3300024493 Ga0264413_116327 Ga0264413_1163272 299
107 3300042591 Ga0466692_080945 Ga0466692_080945_538_1437 299
108 3300042597 Ga0466699_217622 Ga0466699_217622_3136_4035 299
109 3300042597 Ga0466699_235112 Ga0466699_235112_3457_4356 299
110 3300042617 Ga0466718_028352 Ga0466718_028352_6490_7389 299
111 3300042618 Ga0466723_342696 Ga0466723_342696_1576_2475 299
112 3300042656 Ga0466732_259914 Ga0466732_259914_8191_9090 299
113 3300042656 Ga0466732_271304 Ga0466732_271304_159_1058 299
114 3300042609 Ga0466722_003624 Ga0466722_003624_3786_4688 300
115 3300042643 Ga0466704_618400 Ga0466704_618400_20967_21869 300
116 3300042609 Ga0466722_210199 Ga0466722_210199_1868_2773 301
117 3300042594 Ga0466694_138924 Ga0466694_138924_1191_2099 302
118 3300042609 Ga0466722_064257 Ga0466722_064257_7002_7910 302
119 3300042616 Ga0466715_245760 Ga0466715_245760_3227_4135 302
120 3300042593 Ga0466691_000335 Ga0466691_000335_11864_12775 303
121 3300042607 Ga0466720_027066 Ga0466720_027066_5999_6910 303
122 3300042609 Ga0466722_038290 Ga0466722_038290_8456_9367 303
123 3300042612 Ga0466705_240811 Ga0466705_240811_2416_3327 303
124 3300002450 JGI24695J34938_10040845 JGI24695J34938_100408452 304
125 3300042616 Ga0466715_074677 Ga0466715_074677_3533_4447 304
126 3300042618 Ga0466723_207720 Ga0466723_207720_1613_2530 305
127 3300042594 Ga0466694_014107 Ga0466694_014107_1723_2700 306
128 3300042618 Ga0466723_012739 Ga0466723_012739_12742_13662 306
129 3300005201 Ga0072941_1065726 Ga0072941_10657263 307
130 3300042590 Ga0466690_106973 Ga0466690_106973_507_1436 309
131 3300042610 Ga0466698_362086 Ga0466698_362086_837_1766 309
132 3300042590 Ga0466690_337054 Ga0466690_337054_4003_4938 311
133 3300042617 Ga0466718_109414 Ga0466718_109414_8486_9424 312
134 3300002449 JGI24698J34947_10043076 JGI24698J34947_100430762 319
135 3300042597 Ga0466699_270503 Ga0466699_270503_113_1075 320
136 3300042607 Ga0466720_093590 Ga0466720_093590_99_1070 323
137 3300024493 Ga0264413_106251 Ga0264413_1062514 340

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02811 PHP PHP domain 50 107 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02811 GO:0003824 catalytic activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.