Protein Family IF04163
Metagenome
Isolate
137
Members
47
Samples
131
Scaffolds
293.15
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_106251|Ga0264413_1062514
- Length
- 340 aa
- Sequence
- LPLRGNNVFTLDTQTAGAHFFAIGYQHPPGQCIFQIKTVLLLILFXSNASDGDFSPAQLIREAQKRGITVLALTDHDTLGGLKGAQGEANAVGVRFIPGIEISINWTKTAGASGLGPGGEMHLLGLGIKTPSPAFLAAIAELSRRREERNREILDNMNALGIEASWDDILAETGLSLTYPVGASVSSLSIGRPHFASFLVKRKIVRNKDQAFARYLKPGKPLFVPKAGLPFGQAAALIRESGGIPVLAHPMSLYVAWGCLPDLVKALKNQGLMGIEAWHPIAKARACHRLEELGRGLGLYITEGSDFHGTTRVGRYLGISNKGREISESVLEAIPELFYP
Sample Types
Isolate
3.6%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
28.9%
Unclassified
17.8%
Rhinotermitidae
6.7%
Termopsidae
4.4%
Taxonomy
Archaea
1
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 7 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 8 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 37 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_297853 | 3300042636 | Bacteria | 2680 |
| 2 | JGI24698J34947_10000602 | 3300002449 | Bacteria | 17226 |
| 3 | Ga0466718_107560 | 3300042617 | Bacteria | 3588 |
| 4 | Ga0466694_138924 | 3300042594 | Bacteria | 3789 |
| 5 | Ga0466699_023711 | 3300042597 | Bacteria | 1980 |
| 6 | Ga0466699_217622 | 3300042597 | Bacteria | 7492 |
| 7 | Ga0466720_073893 | 3300042607 | Bacteria | 3287 |
| 8 | Ga0466709_245705 | 3300042648 | Bacteria | 10723 |
| 9 | JGI24698J34947_10019593 | 3300002449 | Unclassified | 3647 |
| 10 | JGI24698J34947_10027377 | 3300002449 | Bacteria | 3025 |
| 11 | JGI24698J34947_10079729 | 3300002449 | Bacteria | 1541 |
| 12 | Ga0466712_007308 | 3300042614 | Bacteria | 17090 |
| 13 | Ga0466712_291404 | 3300042614 | Unclassified | 1811 |
| 14 | Ga0466715_080388 | 3300042616 | Bacteria | 3423 |
| 15 | Ga0466715_586083 | 3300042616 | Bacteria | 3791 |
| 16 | Ga0466718_081859 | 3300042617 | Bacteria | 1601 |
| 17 | Ga0466690_337054 | 3300042590 | Bacteria | 5097 |
| 18 | Ga0466716_288812 | 3300042605 | Bacteria | 4326 |
| 19 | Ga0466720_115208 | 3300042607 | Bacteria | 9027 |
| 20 | Ga0466720_126151 | 3300042607 | Unclassified | 2534 |
| 21 | Ga0466720_166905 | 3300042607 | Unclassified | 3168 |
| 22 | Ga0466732_271304 | 3300042656 | Bacteria | 13044 |
| 23 | JGI24698J34947_10052222 | 3300002449 | Bacteria | 2052 |
| 24 | JGI24695J34938_10040845 | 3300002450 | Bacteria | 2086 |
| 25 | JGI24699J35502_11082207 | 3300002509 | Unclassified | 1992 |
| 26 | JGI24699J35502_11131451 | 3300002509 | Bacteria | 5718 |
| 27 | Ga0072941_1055817 | 3300005201 | Bacteria | 5068 |
| 28 | Ga0466712_227086 | 3300042614 | Bacteria | 3198 |
| 29 | Ga0466723_012739 | 3300042618 | Bacteria | 44053 |
| 30 | Ga0466723_136808 | 3300042618 | Bacteria | 5360 |
| 31 | Ga0466723_231664 | 3300042618 | Bacteria | 2506 |
| 32 | Ga0466699_374924 | 3300042597 | Bacteria | 1166 |
| 33 | Ga0466700_088653 | 3300042600 | Bacteria | 1998 |
| 34 | Ga0466719_502114 | 3300042606 | Bacteria | 3507 |
| 35 | Ga0466720_037955 | 3300042607 | Bacteria | 4880 |
| 36 | Ga0466705_240811 | 3300042612 | Bacteria | 25843 |
| 37 | Ga0466732_302524 | 3300042656 | Bacteria | 1301 |
| 38 | Ga0466709_373657 | 3300042648 | Bacteria | 2445 |
| 39 | Ga0466708_224073 | 3300042652 | Bacteria | 40955 |
| 40 | JGI24698J34947_10094254 | 3300002449 | Unclassified | 1364 |
| 41 | JGI24695J34938_10032226 | 3300002450 | Bacteria | 2423 |
| 42 | Ga0072941_1036489 | 3300005201 | Bacteria | 5954 |
| 43 | Ga0123356_10317545 | 3300010049 | Bacteria | 1670 |
| 44 | Ga0466712_059558 | 3300042614 | Bacteria | 4833 |
| 45 | Ga0466712_091644 | 3300042614 | Bacteria | 12686 |
| 46 | Ga0466715_074677 | 3300042616 | Bacteria | 46767 |
| 47 | Ga0466718_036583 | 3300042617 | Bacteria | 24017 |
| 48 | Ga0264413_106251 | 3300024493 | Bacteria | 6350 |
| 49 | Ga0264413_129783 | 3300024493 | Bacteria | 3246 |
| 50 | Ga0466690_106973 | 3300042590 | Bacteria | 3250 |
| 51 | Ga0466692_080945 | 3300042591 | Bacteria | 1654 |
| 52 | Ga0466693_416307 | 3300042592 | Bacteria | 2597 |
| 53 | Ga0466691_052389 | 3300042593 | Bacteria | 5135 |
| 54 | Ga0466694_032891 | 3300042594 | Bacteria | 2809 |
| 55 | Ga0466707_152939 | 3300042601 | Bacteria | 8076 |
| 56 | Ga0466714_017715 | 3300042603 | Bacteria | 1658 |
| 57 | Ga0466720_093590 | 3300042607 | Bacteria | 1375 |
| 58 | Ga0466720_209141 | 3300042607 | Bacteria | 5508 |
| 59 | Ga0466722_003624 | 3300042609 | Bacteria | 6344 |
| 60 | Ga0466722_064257 | 3300042609 | Bacteria | 17947 |
| 61 | Ga0466704_618400 | 3300042643 | Bacteria | 25200 |
| 62 | Ga0072941_1065726 | 3300005201 | Bacteria | 2086 |
| 63 | Ga0466712_068825 | 3300042614 | Bacteria | 8346 |
| 64 | Ga0466712_129347 | 3300042614 | Bacteria | 3476 |
| 65 | Ga0466715_514480 | 3300042616 | Bacteria | 23319 |
| 66 | Ga0466723_342696 | 3300042618 | Bacteria | 4674 |
| 67 | Ga0466726_373788 | 3300042619 | Bacteria | 1235 |
| 68 | Ga0264413_120625 | 3300024493 | Bacteria | 1426 |
| 69 | Ga0466696_479064 | 3300042596 | Bacteria | 10807 |
| 70 | Ga0466699_133028 | 3300042597 | Bacteria | 21739 |
| 71 | Ga0466699_270503 | 3300042597 | Bacteria | 1216 |
| 72 | Ga0466713_044217 | 3300042602 | Bacteria | 4145 |
| 73 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 74 | Ga0466720_206281 | 3300042607 | Bacteria | 2786 |
| 75 | Ga0466732_259914 | 3300042656 | Bacteria | 16987 |
| 76 | AustNasuHG_c1009702 | 3300000089 | Bacteria | 3374 |
| 77 | JGI24698J34947_10043076 | 3300002449 | Bacteria | 2315 |
| 78 | JGI24698J34947_10054403 | 3300002449 | Bacteria | 1999 |
| 79 | Ga0072940_1010885 | 3300005200 | Bacteria | 2408 |
| 80 | Ga0072941_1012972 | 3300005201 | Bacteria | 7473 |
| 81 | Ga0072941_1037334 | 3300005201 | Bacteria | 8402 |
| 82 | Ga0074263_104438 | 3300005485 | Bacteria | 3160 |
| 83 | Ga0466712_012768 | 3300042614 | Bacteria | 2721 |
| 84 | Ga0466711_233568 | 3300042615 | Bacteria | 4096 |
| 85 | Ga0466715_245760 | 3300042616 | Bacteria | 4747 |
| 86 | Ga0466718_003939 | 3300042617 | Bacteria | 3115 |
| 87 | Ga0466718_091643 | 3300042617 | Bacteria | 1233 |
| 88 | Ga0466723_207720 | 3300042618 | Bacteria | 5409 |
| 89 | Ga0466726_378883 | 3300042619 | Bacteria | 1092 |
| 90 | Ga0264413_116327 | 3300024493 | Bacteria | 2056 |
| 91 | Ga0466694_134099 | 3300042594 | Bacteria | 1981 |
| 92 | Ga0466699_054526 | 3300042597 | Bacteria | 3412 |
| 93 | Ga0466699_437768 | 3300042597 | Bacteria | 1347 |
| 94 | Ga0466720_018396 | 3300042607 | Bacteria | 25285 |
| 95 | Ga0466698_362086 | 3300042610 | Bacteria | 4354 |
| 96 | Ga0466705_293436 | 3300042612 | Bacteria | 17863 |
| 97 | Ga0466729_236729 | 3300042621 | Bacteria | 1432 |
| 98 | Ga0466709_220857 | 3300042648 | Bacteria | 13847 |
| 99 | JGI24698J34947_10009743 | 3300002449 | Bacteria | 5268 |
| 100 | JGI24698J34947_10012965 | 3300002449 | Bacteria | 4554 |
| 101 | JGI24698J34947_10034500 | 3300002449 | Bacteria | 2647 |
| 102 | Ga0123355_10057438 | 3300009826 | Bacteria | 6296 |
| 103 | Ga0123355_10358857 | 3300009826 | Archaea | 1922 |
| 104 | Ga0123356_10001166 | 3300010049 | Bacteria | 29061 |
| 105 | Ga0466712_037680 | 3300042614 | Unclassified | 1958 |
| 106 | Ga0466718_028352 | 3300042617 | Bacteria | 18467 |
| 107 | Ga0466729_195335 | 3300042621 | Bacteria | 1047 |
| 108 | Ga0466692_062464 | 3300042591 | Bacteria | 15794 |
| 109 | Ga0466691_000335 | 3300042593 | Bacteria | 15328 |
| 110 | Ga0466691_224774 | 3300042593 | Bacteria | 9308 |
| 111 | Ga0466699_103691 | 3300042597 | Bacteria | 17413 |
| 112 | Ga0466699_235112 | 3300042597 | Bacteria | 5684 |
| 113 | Ga0466699_396151 | 3300042597 | Bacteria | 3418 |
| 114 | Ga0466720_027066 | 3300042607 | Bacteria | 16538 |
| 115 | Ga0466732_008326 | 3300042656 | Bacteria | 1146 |
| 116 | Ga0466735_142022 | 3300042624 | Bacteria | 1440 |
| 117 | Ga0466704_031252 | 3300042643 | Bacteria | 4694 |
| 118 | JGI24698J34947_10019603 | 3300002449 | Bacteria | 3646 |
| 119 | Ga0068305_10224554 | 3300005083 | Bacteria | 17377 |
| 120 | Ga0072941_1012860 | 3300005201 | Bacteria | 7543 |
| 121 | Ga0072941_1054309 | 3300005201 | Unclassified | 12024 |
| 122 | Ga0466705_411344 | 3300042612 | Bacteria | 8082 |
| 123 | Ga0466712_071887 | 3300042614 | Bacteria | 17078 |
| 124 | Ga0466712_324304 | 3300042614 | Bacteria | 24690 |
| 125 | Ga0466718_010209 | 3300042617 | Bacteria | 2425 |
| 126 | Ga0466718_109414 | 3300042617 | Bacteria | 16236 |
| 127 | Ga0466694_014107 | 3300042594 | Bacteria | 2911 |
| 128 | Ga0466717_011181 | 3300042604 | Bacteria | 1820 |
| 129 | Ga0466720_163349 | 3300042607 | Bacteria | 9865 |
| 130 | Ga0466722_038290 | 3300042609 | Bacteria | 10223 |
| 131 | Ga0466722_210199 | 3300042609 | Bacteria | 4460 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005201 | Ga0072941_1012860 | Ga0072941_10128606 | 257 |
| 2 | 3300005200 | Ga0072940_1010885 | Ga0072940_10108852 | 266 |
| 3 | 3300009826 | Ga0123355_10358857 | Ga0123355_103588571 | 272 |
| 4 | 3300042607 | Ga0466720_018396 | Ga0466720_018396_23074_23952 | 273 |
| 5 | 3300042617 | Ga0466718_107560 | Ga0466718_107560_2257_3084 | 275 |
| 6 | 3300042621 | Ga0466729_236729 | Ga0466729_236729_197_1024 | 275 |
| 7 | 3300042656 | Ga0466732_302524 | Ga0466732_302524_19_846 | 275 |
| 8 | 3300042607 | Ga0466720_209141 | Ga0466720_209141_4041_4877 | 278 |
| 9 | 3300042607 | Ga0466720_177676 | Ga0466720_177676_28281_29120 | 279 |
| 10 | 3300042607 | Ga0466720_115208 | Ga0466720_115208_4691_5539 | 282 |
| 11 | 3300042614 | Ga0466712_091644 | Ga0466712_091644_426_1316 | 282 |
| 12 | 3300042618 | Ga0466723_231664 | Ga0466723_231664_219_1067 | 282 |
| 13 | 3300042643 | Ga0466704_031252 | Ga0466704_031252_3144_3992 | 282 |
| 14 | 3300042656 | Ga0466732_008326 | Ga0466732_008326_56_904 | 282 |
| 15 | 3300042601 | Ga0466707_152939 | Ga0466707_152939_3254_4105 | 283 |
| 16 | 3300042607 | Ga0466720_073893 | Ga0466720_073893_1302_2201 | 283 |
| 17 | 3300042612 | Ga0466705_411344 | Ga0466705_411344_4056_4907 | 283 |
| 18 | 3300042615 | Ga0466711_233568 | Ga0466711_233568_10_861 | 283 |
| 19 | 3300042621 | Ga0466729_195335 | Ga0466729_195335_165_1016 | 283 |
| 20 | 3300002450 | JGI24695J34938_10032226 | JGI24695J34938_100322262 | 286 |
| 21 | 3300005201 | Ga0072941_1012972 | Ga0072941_10129722 | 286 |
| 22 | 3300042594 | Ga0466694_032891 | Ga0466694_032891_924_1784 | 286 |
| 23 | 3300042614 | Ga0466712_007308 | Ga0466712_007308_6659_7519 | 286 |
| 24 | 3300042614 | Ga0466712_129347 | Ga0466712_129347_203_1063 | 286 |
| 25 | 3300042614 | Ga0466712_227086 | Ga0466712_227086_2235_3095 | 286 |
| 26 | 3300002449 | JGI24698J34947_10000602 | JGI24698J34947_1000060215 | 287 |
| 27 | 3300002449 | JGI24698J34947_10019593 | JGI24698J34947_100195932 | 287 |
| 28 | 3300002509 | JGI24699J35502_11082207 | JGI24699J35502_110822071 | 287 |
| 29 | 3300005201 | Ga0072941_1037334 | Ga0072941_10373342 | 287 |
| 30 | 3300042603 | Ga0466714_017715 | Ga0466714_017715_703_1566 | 287 |
| 31 | 3300042619 | Ga0466726_373788 | Ga0466726_373788_269_1132 | 287 |
| 32 | 3300042652 | Ga0466708_224073 | Ga0466708_224073_36344_37207 | 287 |
| 33 | 3300024493 | Ga0264413_120625 | Ga0264413_1206252 | 288 |
| 34 | 3300042593 | Ga0466691_224774 | Ga0466691_224774_1281_2147 | 288 |
| 35 | 3300042597 | Ga0466699_437768 | Ga0466699_437768_468_1334 | 288 |
| 36 | 3300042616 | Ga0466715_080388 | Ga0466715_080388_2332_3198 | 288 |
| 37 | iso_pr_bacteria | 2781125633 | 2781272212 | 288 |
| 38 | 3300042612 | Ga0466705_293436 | Ga0466705_293436_8586_9455 | 289 |
| 39 | 3300002449 | JGI24698J34947_10027377 | JGI24698J34947_100273772 | 290 |
| 40 | 3300002449 | JGI24698J34947_10052222 | JGI24698J34947_100522222 | 290 |
| 41 | 3300005083 | Ga0068305_10224554 | Ga0068305_1022455413 | 290 |
| 42 | 3300005201 | Ga0072941_1055817 | Ga0072941_10558172 | 290 |
| 43 | 3300042597 | Ga0466699_023711 | Ga0466699_023711_227_1099 | 290 |
| 44 | 3300042597 | Ga0466699_054526 | Ga0466699_054526_1162_2034 | 290 |
| 45 | 3300042597 | Ga0466699_103691 | Ga0466699_103691_1086_1958 | 290 |
| 46 | 3300042597 | Ga0466699_133028 | Ga0466699_133028_12572_13444 | 290 |
| 47 | 3300042597 | Ga0466699_374924 | Ga0466699_374924_182_1054 | 290 |
| 48 | 3300042597 | Ga0466699_396151 | Ga0466699_396151_1477_2349 | 290 |
| 49 | 3300042602 | Ga0466713_044217 | Ga0466713_044217_1791_2663 | 290 |
| 50 | 3300042605 | Ga0466716_288812 | Ga0466716_288812_3092_3964 | 290 |
| 51 | 3300042607 | Ga0466720_163349 | Ga0466720_163349_7231_8103 | 290 |
| 52 | 3300042614 | Ga0466712_291404 | Ga0466712_291404_376_1248 | 290 |
| 53 | 3300002449 | JGI24698J34947_10019603 | JGI24698J34947_100196032 | 291 |
| 54 | 3300002449 | JGI24698J34947_10034500 | JGI24698J34947_100345002 | 291 |
| 55 | 3300009826 | Ga0123355_10057438 | Ga0123355_100574385 | 291 |
| 56 | 3300042594 | Ga0466694_134099 | Ga0466694_134099_290_1165 | 291 |
| 57 | 3300042604 | Ga0466717_011181 | Ga0466717_011181_240_1115 | 291 |
| 58 | 3300042606 | Ga0466719_502114 | Ga0466719_502114_1932_2807 | 291 |
| 59 | 3300042618 | Ga0466723_136808 | Ga0466723_136808_4426_5301 | 291 |
| 60 | 3300042636 | Ga0466703_297853 | Ga0466703_297853_626_1501 | 291 |
| 61 | iso_pr_bacteria | 2781125631 | 2781268388 | 291 |
| 62 | 3300005485 | Ga0074263_104438 | Ga0074263_1044383 | 292 |
| 63 | 3300010049 | Ga0123356_10317545 | Ga0123356_103175451 | 292 |
| 64 | 3300042607 | Ga0466720_037955 | Ga0466720_037955_2914_3792 | 292 |
| 65 | 3300042607 | Ga0466720_126151 | Ga0466720_126151_650_1528 | 292 |
| 66 | 3300042607 | Ga0466720_206281 | Ga0466720_206281_1336_2214 | 292 |
| 67 | 3300042614 | Ga0466712_012768 | Ga0466712_012768_1452_2330 | 292 |
| 68 | 3300042614 | Ga0466712_037680 | Ga0466712_037680_94_972 | 292 |
| 69 | 3300042614 | Ga0466712_071887 | Ga0466712_071887_10196_11074 | 292 |
| 70 | 3300042617 | Ga0466718_081859 | Ga0466718_081859_140_1045 | 292 |
| 71 | 3300042648 | Ga0466709_220857 | Ga0466709_220857_5222_6100 | 292 |
| 72 | iso_pr_bacteria | 2781125689 | 2781426056 | 292 |
| 73 | 3300002449 | JGI24698J34947_10012965 | JGI24698J34947_100129653 | 293 |
| 74 | 3300002449 | JGI24698J34947_10054403 | JGI24698J34947_100544032 | 293 |
| 75 | 3300002509 | JGI24699J35502_11131451 | JGI24699J35502_111314516 | 293 |
| 76 | 3300042596 | Ga0466696_479064 | Ga0466696_479064_7890_8795 | 293 |
| 77 | 3300042607 | Ga0466720_018396 | Ga0466720_018396_9728_10609 | 293 |
| 78 | 3300042607 | Ga0466720_166905 | Ga0466720_166905_1331_2212 | 293 |
| 79 | 3300005201 | Ga0072941_1054309 | Ga0072941_105430912 | 294 |
| 80 | 3300042617 | Ga0466718_091643 | Ga0466718_091643_253_1137 | 294 |
| 81 | 3300042648 | Ga0466709_245705 | Ga0466709_245705_2266_3150 | 294 |
| 82 | 3300042614 | Ga0466712_068825 | Ga0466712_068825_7258_8145 | 295 |
| 83 | 3300042614 | Ga0466712_324304 | Ga0466712_324304_9164_10051 | 295 |
| 84 | iso_pr_bacteria | 2781125658 | 2781325145 | 295 |
| 85 | 3300002449 | JGI24698J34947_10094254 | JGI24698J34947_100942542 | 296 |
| 86 | 3300010049 | Ga0123356_10001166 | Ga0123356_1000116616 | 296 |
| 87 | 3300042591 | Ga0466692_062464 | Ga0466692_062464_5848_6738 | 296 |
| 88 | 3300042592 | Ga0466693_416307 | Ga0466693_416307_1032_1922 | 296 |
| 89 | 3300042593 | Ga0466691_052389 | Ga0466691_052389_250_1140 | 296 |
| 90 | 3300042600 | Ga0466700_088653 | Ga0466700_088653_425_1315 | 296 |
| 91 | 3300042616 | Ga0466715_514480 | Ga0466715_514480_4687_5577 | 296 |
| 92 | 3300042616 | Ga0466715_586083 | Ga0466715_586083_1152_2042 | 296 |
| 93 | 3300042617 | Ga0466718_003939 | Ga0466718_003939_771_1661 | 296 |
| 94 | 3300042617 | Ga0466718_010209 | Ga0466718_010209_95_985 | 296 |
| 95 | 3300042619 | Ga0466726_378883 | Ga0466726_378883_55_945 | 296 |
| 96 | 3300042624 | Ga0466735_142022 | Ga0466735_142022_379_1269 | 296 |
| 97 | 3300042648 | Ga0466709_373657 | Ga0466709_373657_166_1056 | 296 |
| 98 | 3300002449 | JGI24698J34947_10079729 | JGI24698J34947_100797292 | 297 |
| 99 | 3300042617 | Ga0466718_036583 | Ga0466718_036583_4438_5331 | 297 |
| 100 | iso_pr_bacteria | 2781125640 | 2781287205 | 297 |
| 101 | 3300005201 | Ga0072941_1036489 | Ga0072941_10364893 | 298 |
| 102 | 3300024493 | Ga0264413_129783 | Ga0264413_1297835 | 298 |
| 103 | 3300042614 | Ga0466712_059558 | Ga0466712_059558_2664_3560 | 298 |
| 104 | 3300000089 | AustNasuHG_c1009702 | AustNasuHG_10097022 | 299 |
| 105 | 3300002449 | JGI24698J34947_10009743 | JGI24698J34947_100097432 | 299 |
| 106 | 3300024493 | Ga0264413_116327 | Ga0264413_1163272 | 299 |
| 107 | 3300042591 | Ga0466692_080945 | Ga0466692_080945_538_1437 | 299 |
| 108 | 3300042597 | Ga0466699_217622 | Ga0466699_217622_3136_4035 | 299 |
| 109 | 3300042597 | Ga0466699_235112 | Ga0466699_235112_3457_4356 | 299 |
| 110 | 3300042617 | Ga0466718_028352 | Ga0466718_028352_6490_7389 | 299 |
| 111 | 3300042618 | Ga0466723_342696 | Ga0466723_342696_1576_2475 | 299 |
| 112 | 3300042656 | Ga0466732_259914 | Ga0466732_259914_8191_9090 | 299 |
| 113 | 3300042656 | Ga0466732_271304 | Ga0466732_271304_159_1058 | 299 |
| 114 | 3300042609 | Ga0466722_003624 | Ga0466722_003624_3786_4688 | 300 |
| 115 | 3300042643 | Ga0466704_618400 | Ga0466704_618400_20967_21869 | 300 |
| 116 | 3300042609 | Ga0466722_210199 | Ga0466722_210199_1868_2773 | 301 |
| 117 | 3300042594 | Ga0466694_138924 | Ga0466694_138924_1191_2099 | 302 |
| 118 | 3300042609 | Ga0466722_064257 | Ga0466722_064257_7002_7910 | 302 |
| 119 | 3300042616 | Ga0466715_245760 | Ga0466715_245760_3227_4135 | 302 |
| 120 | 3300042593 | Ga0466691_000335 | Ga0466691_000335_11864_12775 | 303 |
| 121 | 3300042607 | Ga0466720_027066 | Ga0466720_027066_5999_6910 | 303 |
| 122 | 3300042609 | Ga0466722_038290 | Ga0466722_038290_8456_9367 | 303 |
| 123 | 3300042612 | Ga0466705_240811 | Ga0466705_240811_2416_3327 | 303 |
| 124 | 3300002450 | JGI24695J34938_10040845 | JGI24695J34938_100408452 | 304 |
| 125 | 3300042616 | Ga0466715_074677 | Ga0466715_074677_3533_4447 | 304 |
| 126 | 3300042618 | Ga0466723_207720 | Ga0466723_207720_1613_2530 | 305 |
| 127 | 3300042594 | Ga0466694_014107 | Ga0466694_014107_1723_2700 | 306 |
| 128 | 3300042618 | Ga0466723_012739 | Ga0466723_012739_12742_13662 | 306 |
| 129 | 3300005201 | Ga0072941_1065726 | Ga0072941_10657263 | 307 |
| 130 | 3300042590 | Ga0466690_106973 | Ga0466690_106973_507_1436 | 309 |
| 131 | 3300042610 | Ga0466698_362086 | Ga0466698_362086_837_1766 | 309 |
| 132 | 3300042590 | Ga0466690_337054 | Ga0466690_337054_4003_4938 | 311 |
| 133 | 3300042617 | Ga0466718_109414 | Ga0466718_109414_8486_9424 | 312 |
| 134 | 3300002449 | JGI24698J34947_10043076 | JGI24698J34947_100430762 | 319 |
| 135 | 3300042597 | Ga0466699_270503 | Ga0466699_270503_113_1075 | 320 |
| 136 | 3300042607 | Ga0466720_093590 | Ga0466720_093590_99_1070 | 323 |
| 137 | 3300024493 | Ga0264413_106251 | Ga0264413_1062514 | 340 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02811 | PHP | PHP domain | 50 | 107 | 0.81 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02811 | GO:0003824 | catalytic activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.