Protein Family IF04158

Metagenome Isolate
174 Members
61 Samples
155 Scaffolds
436.26 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_103772|Ga0264413_1037727
Length
527 aa
Sequence
MFEKLTEKITDAFRFVTGKSSISEKNIEDAVEAIKMALLDADVNLRVVRRFVNSTIEEAKGEKVLRSVDPSQQFIKIVHDKLVSFLGDADPASRALKLRGPDVISAVLMLGLQGSGKTTSSAKLALRLKKEGRKPMLVACDLVRPAAMEQLAVLGSQIGIPVHKEEGAKDSVKVYQNALSWANQNMIDTMIIDTTGRLQIDEPMMQELSRLKDAAKPDEMLLVADSMTGQAAADIAKTFDEKIGLTGVVLTKFDSDTRGGAALSLKTVTGKPLKFTGTGEKPEDFEPFHPDRLAGRILGMGDVVSLVEKAQEVINEKEALELQKKMEKENFTLEDWLSQLRAVKKMGSLQKMLEMIPGMQGQINEEDINKEELKHQEAILSSMTRKERANHLIIGPPRRSRIARGSGTSVAEVARLLKKFEKMRGMMKXHFVLFYPIDNFIDLAEDKACDGIGAAVVNRDFACVLVNKRGDGECYVRNVSGQFVNFTRVNYVRTRTRYYFPRLVNVKQGGAERINKTVTACKHSVVE

📊 Sample Types

Isolate 10.9%
Metagenome 89.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 30.0%
Kalotermitidae 25.0%
Termopsidae 5.0%
Rhinotermitidae 3.3%
Hodotermitidae 1.7%
Blaberidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 156
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
15 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
16 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
23 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
24 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
37 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
38 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
39 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
42 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
51 2772190975 Treponema sp. RmG30 Isolate Blaberidae
52 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
53 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
54 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
55 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
56 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
57 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
58 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
61 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_007728 3300042622 Bacteria 2201
2 Ga0466735_001415 3300042624 Bacteria 8409
3 Ga0466704_118806 3300042643 Bacteria 5280
4 Ga0466704_128230 3300042643 Bacteria 41528
5 Ga0123356_10092185 3300010049 Bacteria 2889
6 Ga0466715_142625 3300042616 Bacteria 21529
7 Ga0466723_056519 3300042618 Unclassified 6190
8 Ga0466726_307308 3300042619 Bacteria 7425
9 Ga0466690_060591 3300042590 Bacteria 7889
10 Ga0466690_333748 3300042590 Bacteria 2299
11 Ga0466691_010908 3300042593 Bacteria 139266
12 Ga0466691_037124 3300042593 Bacteria 15978
13 Ga0466691_097940 3300042593 Bacteria 12799
14 Ga0466696_116902 3300042596 Bacteria 91607
15 Ga0466699_154656 3300042597 Bacteria 11689
16 Ga0466699_245995 3300042597 Unclassified 3262
17 Ga0466706_247697 3300042599 Bacteria 2380
18 Ga0466722_076177 3300042609 Bacteria 29982
19 Ga0466705_167337 3300042612 Unclassified 1477
20 Ga0466703_160544 3300042636 Unclassified 5416
21 Ga0466709_125917 3300042648 Unclassified 4137
22 Ga0466708_240405 3300042652 Bacteria 15347
23 Ga0466712_023799 3300042614 Bacteria 49566
24 Ga0466711_044755 3300042615 Bacteria 11171
25 Ga0466718_081136 3300042617 Bacteria 2943
26 Ga0466723_212537 3300042618 Bacteria 9854
27 Ga0466728_295496 3300042620 Bacteria 96280
28 Ga0466692_084841 3300042591 Bacteria 12847
29 Ga0466693_244531 3300042592 Bacteria 3216
30 Ga0466694_268649 3300042594 Bacteria 30529
31 Ga0466696_389216 3300042596 Bacteria 1816
32 Ga0466706_165313 3300042599 Bacteria 60368
33 Ga0466719_041805 3300042606 Bacteria 4419
34 Ga0466719_090346 3300042606 Bacteria 25819
35 Ga0466720_015605 3300042607 Unclassified 4095
36 Ga0466721_191339 3300042608 Bacteria 79638
37 JGI24695J34938_10000878 3300002450 Bacteria 27738
38 JGI24705J35276_12228487 3300002504 Bacteria 3194
39 Ga0072940_1000897 3300005200 Bacteria 20293
40 Ga0466705_078763 3300042612 Bacteria 55629
41 Ga0466704_210643 3300042643 Bacteria 2995
42 Ga0466704_305893 3300042643 Bacteria 25055
43 Ga0466704_578777 3300042643 Bacteria 40746
44 Ga0466727_288643 3300042655 Bacteria 4885
45 Ga0123356_10004228 3300010049 Bacteria 14850
46 Ga0123356_10013594 3300010049 Unclassified 7847
47 Ga0466712_090145 3300042614 Bacteria 11614
48 Ga0466715_486601 3300042616 Unclassified 4166
49 Ga0466723_015264 3300042618 Bacteria 20872
50 Ga0466723_029624 3300042618 Bacteria 5456
51 Ga0264413_105193 3300024493 Bacteria 48930
52 Ga0466657_095660 3300042582 Bacteria 23452
53 Ga0466694_207285 3300042594 Bacteria 1528
54 Ga0466696_191503 3300042596 Bacteria 28288
55 Ga0466699_300759 3300042597 Unclassified 7050
56 Ga0466707_218734 3300042601 Bacteria 20681
57 Ga0466720_163349 3300042607 Bacteria 9865
58 JGI24695J34938_10001109 3300002450 Bacteria 24296
59 JGI24695J34938_10001520 3300002450 Bacteria 19548
60 JGI24695J34938_10013491 3300002450 Bacteria 4289
61 Ga0466705_085472 3300042612 Unclassified 1477
62 Ga0466705_105065 3300042612 Bacteria 19900
63 Ga0466704_195348 3300042643 Bacteria 13077
64 Ga0466704_408972 3300042643 Bacteria 12038
65 Ga0466708_188080 3300042652 Unclassified 6223
66 Ga0466715_065687 3300042616 Bacteria 3581
67 Ga0466723_117599 3300042618 Bacteria 7954
68 Ga0466694_179316 3300042594 Bacteria 7133
69 Ga0466699_434667 3300042597 Unclassified 2111
70 Ga0466716_216137 3300042605 Bacteria 4457
71 Ga0466716_311153 3300042605 Bacteria 20308
72 Ga0466719_016747 3300042606 Bacteria 5759
73 Ga0466720_177676 3300042607 Bacteria 91443
74 Ga0466722_072637 3300042609 Bacteria 8065
75 Ga0466722_180419 3300042609 Bacteria 9896
76 Ga0466722_194007 3300042609 Bacteria 6135
77 Ga0466705_126761 3300042612 Bacteria 31942
78 Ga0466704_019245 3300042643 Bacteria 5002
79 Ga0466704_391063 3300042643 Bacteria 3408
80 Ga0466708_027170 3300042652 Bacteria 1785
81 Ga0466708_096365 3300042652 Bacteria 19029
82 Ga0466727_284695 3300042655 Bacteria 2643
83 Ga0123356_10000488 3300010049 Bacteria 44166
84 Ga0123356_10030797 3300010049 Unclassified 5020
85 Ga0123353_10214401 3300010167 Bacteria 3017
86 Ga0466711_347398 3300042615 Bacteria 2653
87 Ga0466715_130758 3300042616 Unclassified 2304
88 Ga0466715_518326 3300042616 Unclassified 4110
89 Ga0466726_495932 3300042619 Bacteria 22229
90 Ga0466700_210165 3300042600 Bacteria 3702
91 Ga0466719_220651 3300042606 Bacteria 8059
92 JGI24698J34947_10007746 3300002449 Bacteria 5901
93 Ga0074263_110213 3300005485 Unclassified 3202
94 Ga0466703_004769 3300042636 Bacteria 8521
95 Ga0466708_466672 3300042652 Bacteria 38602
96 Ga0123356_10071668 3300010049 Bacteria 3253
97 Ga0466711_027821 3300042615 Bacteria 32058
98 Ga0466711_414791 3300042615 Bacteria 10745
99 Ga0466728_045214 3300042620 Bacteria 13285
100 Ga0415639_026009 3300038395 Bacteria 1674
101 Ga0466690_022221 3300042590 Bacteria 12516
102 Ga0466694_358738 3300042594 Bacteria 5162
103 Ga0466699_401445 3300042597 Bacteria 12931
104 Ga0466706_157211 3300042599 Bacteria 3802
105 Ga0466719_023565 3300042606 Bacteria 7205
106 Ga0466719_354603 3300042606 Bacteria 18280
107 Ga0466722_177094 3300042609 Bacteria 7534
108 Ga0466722_215340 3300042609 Bacteria 21945
109 AustNasuHG_c1022489 3300000089 Bacteria 2025
110 JGI24695J34938_10000964 3300002450 Bacteria 26239
111 Ga0466705_063324 3300042612 Bacteria 6247
112 Ga0466709_291922 3300042648 Bacteria 5385
113 Ga0466727_149586 3300042655 Bacteria 2734
114 Ga0466727_178267 3300042655 Bacteria 5306
115 Ga0123356_10000943 3300010049 Bacteria 32172
116 Ga0123356_10014765 3300010049 Bacteria 7502
117 Ga0123356_10016195 3300010049 Bacteria 7121
118 Ga0466712_205514 3300042614 Bacteria 2409
119 Ga0466711_303614 3300042615 Bacteria 16027
120 Ga0466711_364049 3300042615 Bacteria 29051
121 Ga0466715_593879 3300042616 Bacteria 26438
122 Ga0264413_103772 3300024493 Bacteria 6915
123 Ga0466692_157495 3300042591 Bacteria 6333
124 Ga0466691_093375 3300042593 Bacteria 1823
125 Ga0466691_102438 3300042593 Bacteria 7246
126 Ga0466696_288483 3300042596 Bacteria 26421
127 Ga0466696_461655 3300042596 Bacteria 6080
128 Ga0466699_006896 3300042597 Bacteria 13409
129 Ga0466699_229425 3300042597 Bacteria 4525
130 Ga0466699_423178 3300042597 Bacteria 6842
131 Ga0466716_269189 3300042605 Bacteria 5167
132 Ga0466719_416844 3300042606 Bacteria 2612
133 Ga0466722_169490 3300042609 Bacteria 5633
134 AustNasuHG_c1002489 3300000089 Bacteria 6671
135 JGI24698J34947_10021165 3300002449 Unclassified 3502
136 Ga0466705_108183 3300042612 Bacteria 8920
137 Ga0466703_054134 3300042636 Bacteria 22697
138 Ga0466704_148730 3300042643 Bacteria 7961
139 Ga0466709_196026 3300042648 Bacteria 5504
140 Ga0123356_10032247 3300010049 Bacteria 4902
141 Ga0123356_10096993 3300010049 Unclassified 2820
142 Ga0123354_10136902 3300010882 Bacteria 3056
143 Ga0466715_039871 3300042616 Bacteria 33977
144 Ga0466715_394762 3300042616 Bacteria 38358
145 Ga0466715_588852 3300042616 Bacteria 7432
146 Ga0466723_191897 3300042618 Bacteria 3622
147 Ga0466726_079612 3300042619 Bacteria 1703
148 Ga0466692_024187 3300042591 Bacteria 27189
149 Ga0466716_179886 3300042605 Bacteria 19041
150 Ga0466720_033724 3300042607 Bacteria 8840
151 Ga0466722_218056 3300042609 Bacteria 3052
152 AustNasuHG_c1001075 3300000089 Bacteria 9822
153 AustNasuHG_c1004949 3300000089 Bacteria 4766
154 JGI24695J34938_10000581 3300002450 Bacteria 35281
155 JGI24695J34938_10019334 3300002450 Bacteria 3379

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_291922 Ga0466709_291922_786_2102 412
2 3300042612 Ga0466705_167337 Ga0466705_167337_43_1356 413
3 3300042582 Ga0466657_095660 Ga0466657_095660_18324_19673 417
4 3300042599 Ga0466706_165313 Ga0466706_165313_47038_48375 417
5 3300010049 Ga0123356_10030797 Ga0123356_100307972 422
6 3300010049 Ga0123356_10032247 Ga0123356_100322473 422
7 3300042608 Ga0466721_191339 Ga0466721_191339_52499_53854 422
8 3300042609 Ga0466722_076177 Ga0466722_076177_822_2177 422
9 3300042615 Ga0466711_364049 Ga0466711_364049_718_2067 422
10 3300042618 Ga0466723_191897 Ga0466723_191897_1625_2965 422
11 3300042619 Ga0466726_495932 Ga0466726_495932_20237_21586 422
12 3300042652 Ga0466708_027170 Ga0466708_027170_227_1582 422
13 3300042655 Ga0466727_284695 Ga0466727_284695_376_1725 422
14 3300002450 JGI24695J34938_10019334 JGI24695J34938_100193342 423
15 3300010049 Ga0123356_10071668 Ga0123356_100716683 423
16 3300024493 Ga0264413_105193 Ga0264413_10519316 423
17 3300042593 Ga0466691_097940 Ga0466691_097940_1288_2643 423
18 3300042593 Ga0466691_102438 Ga0466691_102438_5663_7003 423
19 3300042597 Ga0466699_006896 Ga0466699_006896_3070_4428 423
20 3300042600 Ga0466700_210165 Ga0466700_210165_1027_2367 423
21 3300042607 Ga0466720_033724 Ga0466720_033724_4911_6254 423
22 3300042607 Ga0466720_177676 Ga0466720_177676_34480_35823 423
23 3300042609 Ga0466722_180419 Ga0466722_180419_6026_7372 423
24 3300042636 Ga0466703_160544 Ga0466703_160544_948_2288 423
25 3300042643 Ga0466704_019245 Ga0466704_019245_2728_4089 423
26 3300042655 Ga0466727_288643 Ga0466727_288643_2849_4186 423
27 3300002450 JGI24695J34938_10001109 JGI24695J34938_1000110911 424
28 3300005200 Ga0072940_1000897 Ga0072940_100089715 424
29 3300010167 Ga0123353_10214401 Ga0123353_102144013 424
30 3300042593 Ga0466691_093375 Ga0466691_093375_297_1649 424
31 3300042605 Ga0466716_216137 Ga0466716_216137_2600_3946 424
32 3300042606 Ga0466719_090346 Ga0466719_090346_10266_11630 424
33 3300042607 Ga0466720_163349 Ga0466720_163349_1642_2985 424
34 3300042614 Ga0466712_090145 Ga0466712_090145_2079_3416 424
35 3300042616 Ga0466715_065687 Ga0466715_065687_137_1486 424
36 3300002450 JGI24695J34938_10013491 JGI24695J34938_100134913 425
37 3300005485 Ga0074263_110213 Ga0074263_1102134 425
38 3300042597 Ga0466699_423178 Ga0466699_423178_563_1912 425
39 3300042606 Ga0466719_016747 Ga0466719_016747_4191_5543 425
40 3300042607 Ga0466720_015605 Ga0466720_015605_2734_4077 425
41 3300042614 Ga0466712_205514 Ga0466712_205514_812_2167 425
42 3300042616 Ga0466715_394762 Ga0466715_394762_2014_3363 425
43 3300042617 Ga0466718_081136 Ga0466718_081136_661_2007 425
44 3300042643 Ga0466704_305893 Ga0466704_305893_8515_9861 425
45 3300042652 Ga0466708_188080 Ga0466708_188080_1708_3066 425
46 3300002449 JGI24698J34947_10007746 JGI24698J34947_100077465 426
47 3300002449 JGI24698J34947_10021165 JGI24698J34947_100211652 426
48 3300010882 Ga0123354_10136902 Ga0123354_101369024 426
49 3300042596 Ga0466696_288483 Ga0466696_288483_23555_24907 426
50 3300042597 Ga0466699_300759 Ga0466699_300759_3856_5211 426
51 3300042605 Ga0466716_179886 Ga0466716_179886_12921_14279 426
52 3300042606 Ga0466719_220651 Ga0466719_220651_4356_5669 426
53 3300042609 Ga0466722_072637 Ga0466722_072637_3677_5032 426
54 3300042609 Ga0466722_169490 Ga0466722_169490_513_1874 426
55 3300042614 Ga0466712_023799 Ga0466712_023799_32217_33560 426
56 3300042618 Ga0466723_056519 Ga0466723_056519_2874_4235 426
57 3300000089 AustNasuHG_c1004949 AustNasuHG_10049494 427
58 3300042596 Ga0466696_116902 Ga0466696_116902_29191_30522 427
59 3300042612 Ga0466705_078763 Ga0466705_078763_37244_38596 427
60 3300042643 Ga0466704_578777 Ga0466704_578777_29378_30724 427
61 3300038395 Ga0415639_026009 Ga0415639_026009_163_1506 428
62 3300042591 Ga0466692_024187 Ga0466692_024187_6101_7453 428
63 3300042612 Ga0466705_105065 Ga0466705_105065_13131_14483 428
64 3300042616 Ga0466715_142625 Ga0466715_142625_127_1515 428
65 3300042648 Ga0466709_125917 Ga0466709_125917_2458_3831 428
66 3300042652 Ga0466708_240405 Ga0466708_240405_10267_11613 428
67 3300042652 Ga0466708_466672 Ga0466708_466672_28296_29669 428
68 3300042606 Ga0466719_023565 Ga0466719_023565_2351_3721 429
69 3300042606 Ga0466719_041805 Ga0466719_041805_1754_3127 429
70 3300042609 Ga0466722_218056 Ga0466722_218056_31_1401 429
71 3300042655 Ga0466727_178267 Ga0466727_178267_277_1632 429
72 3300042591 Ga0466692_084841 Ga0466692_084841_1794_3155 430
73 3300042597 Ga0466699_154656 Ga0466699_154656_1641_2990 430
74 3300042605 Ga0466716_311153 Ga0466716_311153_10578_11951 430
75 3300042606 Ga0466719_354603 Ga0466719_354603_16824_18173 430
76 3300042609 Ga0466722_194007 Ga0466722_194007_3689_5041 430
77 3300042616 Ga0466715_039871 Ga0466715_039871_8792_10165 430
78 3300042636 Ga0466703_054134 Ga0466703_054134_8800_10173 430
79 3300042643 Ga0466704_128230 Ga0466704_128230_35720_37096 430
80 3300010049 Ga0123356_10013594 Ga0123356_100135944 431
81 3300042594 Ga0466694_207285 Ga0466694_207285_24_1373 431
82 3300042612 Ga0466705_063324 Ga0466705_063324_1148_2530 431
83 3300042616 Ga0466715_588852 Ga0466715_588852_654_2006 431
84 3300042616 Ga0466715_593879 Ga0466715_593879_6127_7467 431
85 3300042620 Ga0466728_045214 Ga0466728_045214_5217_6587 431
86 3300042643 Ga0466704_148730 Ga0466704_148730_1379_2749 431
87 3300000089 AustNasuHG_c1001075 AustNasuHG_100107510 432
88 3300042612 Ga0466705_085472 Ga0466705_085472_43_1356 432
89 3300042616 Ga0466715_130758 Ga0466715_130758_473_1840 432
90 3300042648 Ga0466709_196026 Ga0466709_196026_2639_4009 432
91 3300042655 Ga0466727_149586 Ga0466727_149586_1309_2655 432
92 3300042593 Ga0466691_010908 Ga0466691_010908_58114_59448 433
93 3300042594 Ga0466694_268649 Ga0466694_268649_25514_26869 433
94 3300042596 Ga0466696_191503 Ga0466696_191503_19015_20376 433
95 3300000089 AustNasuHG_c1022489 AustNasuHG_10224891 435
96 3300002504 JGI24705J35276_12228487 JGI24705J35276_122284872 436
97 3300002450 JGI24695J34938_10000878 JGI24695J34938_1000087819 437
98 3300042616 Ga0466715_486601 Ga0466715_486601_1841_3196 437
99 3300042622 Ga0466731_007728 Ga0466731_007728_399_1745 437
100 3300010049 Ga0123356_10092185 Ga0123356_100921852 438
101 3300042618 Ga0466723_212537 Ga0466723_212537_2975_4291 438
102 3300042590 Ga0466690_060591 Ga0466690_060591_932_2278 439
103 3300042599 Ga0466706_157211 Ga0466706_157211_1978_3297 439
104 3300042606 Ga0466719_416844 Ga0466719_416844_80_1444 440
105 3300042609 Ga0466722_215340 Ga0466722_215340_5290_6657 440
106 3300042643 Ga0466704_118806 Ga0466704_118806_2453_3841 440
107 3300042643 Ga0466704_195348 Ga0466704_195348_10494_11816 440
108 3300042594 Ga0466694_179316 Ga0466694_179316_276_1640 441
109 3300042597 Ga0466699_229425 Ga0466699_229425_2191_3540 441
110 3300042597 Ga0466699_245995 Ga0466699_245995_29_1375 441
111 3300042612 Ga0466705_126761 Ga0466705_126761_19218_20543 441
112 3300042590 Ga0466690_022221 Ga0466690_022221_9883_11211 442
113 3300042605 Ga0466716_269189 Ga0466716_269189_3666_5030 443
114 3300042615 Ga0466711_414791 Ga0466711_414791_16_1365 443
115 iso_pr_bacteria 2781125660 2781331568 443
116 3300010049 Ga0123356_10000943 Ga0123356_1000094321 444
117 3300042624 Ga0466735_001415 Ga0466735_001415_2539_3873 444
118 iso_pr_bacteria 2503904012 2503956787 444
119 3300042596 Ga0466696_461655 Ga0466696_461655_959_2296 445
120 iso_pr_bacteria 2781125637 2781281426 445
121 iso_pr_bacteria 2781125649 2781306339 445
122 3300002450 JGI24695J34938_10001520 JGI24695J34938_1000152011 446
123 3300042616 Ga0466715_518326 Ga0466715_518326_2678_4018 446
124 3300042643 Ga0466704_408972 Ga0466704_408972_1276_2616 446
125 iso_pr_bacteria 2772190978 2773729797 446
126 iso_pr_bacteria 2781125629 2781264684 446
127 iso_pr_bacteria 2781125646 2781301116 446
128 3300000089 AustNasuHG_c1002489 AustNasuHG_10024894 447
129 3300002450 JGI24695J34938_10000581 JGI24695J34938_1000058117 447
130 3300010049 Ga0123356_10016195 Ga0123356_100161954 447
131 3300042594 Ga0466694_358738 Ga0466694_358738_3282_4625 447
132 3300042619 Ga0466726_079612 Ga0466726_079612_151_1494 447
133 iso_pr_bacteria 2781125664 2781339035 447
134 3300010049 Ga0123356_10000488 Ga0123356_1000048820 448
135 3300010049 Ga0123356_10004228 Ga0123356_1000422813 448
136 3300042593 Ga0466691_037124 Ga0466691_037124_2899_4245 448
137 3300042597 Ga0466699_401445 Ga0466699_401445_223_1569 448
138 3300042597 Ga0466699_434667 Ga0466699_434667_221_1567 448
139 3300042615 Ga0466711_347398 Ga0466711_347398_273_1619 448
140 3300042618 Ga0466723_117599 Ga0466723_117599_6214_7560 448
141 3300042620 Ga0466728_295496 Ga0466728_295496_78150_79496 448
142 iso_pr_bacteria 2781125644 2781296607 448
143 iso_pr_bacteria 2781125645 2781298075 448
144 iso_pr_bacteria 2781125651 2781309520 448
145 iso_pr_bacteria 2781125692 2781432514 448
146 iso_pr_bacteria 2819992462 2819992961 448
147 3300042592 Ga0466693_244531 Ga0466693_244531_764_2113 449
148 3300042615 Ga0466711_044755 Ga0466711_044755_3200_4549 449
149 3300042652 Ga0466708_096365 Ga0466708_096365_770_2119 449
150 3300042590 Ga0466690_333748 Ga0466690_333748_687_2039 450
151 3300042612 Ga0466705_108183 Ga0466705_108183_6244_7596 450
152 3300042618 Ga0466723_029624 Ga0466723_029624_976_2328 450
153 3300042619 Ga0466726_307308 Ga0466726_307308_2746_4098 450
154 iso_pr_bacteria 2772190975 2773724697 450
155 3300042591 Ga0466692_157495 Ga0466692_157495_1362_2717 451
156 iso_pr_bacteria 2781125640 2781287214 451
157 3300002450 JGI24695J34938_10000964 JGI24695J34938_1000096415 452
158 3300042618 Ga0466723_015264 Ga0466723_015264_18217_19575 452
159 iso_pr_bacteria 2781125662 2781335286 452
160 3300042609 Ga0466722_177094 Ga0466722_177094_4672_6033 453
161 3300042615 Ga0466711_303614 Ga0466711_303614_12408_13769 453
162 iso_pr_bacteria 2781125683 2781410260 453
163 3300042601 Ga0466707_218734 Ga0466707_218734_8102_9613 454
164 3300042615 Ga0466711_027821 Ga0466711_027821_5027_6430 454
165 3300042643 Ga0466704_210643 Ga0466704_210643_559_1923 454
166 iso_pr_bacteria 2781125632 2781269376 455
167 3300042636 Ga0466703_004769 Ga0466703_004769_6811_8181 456
168 3300042599 Ga0466706_247697 Ga0466706_247697_394_1770 458
169 iso_pr_bacteria 2820142992 2820143170 459
170 3300010049 Ga0123356_10014765 Ga0123356_100147657 462
171 3300010049 Ga0123356_10096993 Ga0123356_100969932 462
172 3300042643 Ga0466704_391063 Ga0466704_391063_564_1961 465
173 3300042596 Ga0466696_389216 Ga0466696_389216_361_1761 466
174 3300024493 Ga0264413_103772 Ga0264413_1037727 527

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00448 SRP54 SRP54-type protein, GTPase domain 106 299 0.99
PF02881 SRP54_N SRP54-type protein, helical bundle domain 5 82 0.95
PF02978 SRP_SPB Signal peptide binding domain 330 427 0.92
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 114 258 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.56 0.64 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.