Protein Family IF04144
Metagenome
Metatranscriptome
Isolate
150
Members
59
Samples
145
Scaffolds
286.06
Avg Length
Representative Sequence
- ID
- 3300021235|Ga0223674_1000241|Ga0223674_10002411
- Length
- 314 aa
- Sequence
- MDKGALIEGFSGCAVRSGLRMARAFRLKEGYMIINHNMSAQYANRQLGVNFNEVAKSIEKLSSGQRINRAGDDASGLAVSEKMRGQIRGLNQAERNIQNGVSFIQATEGYLQETQDILHRLRELSVQSANGIYSDEDRMQIQVEVSQLVDEINRIASHAQFNGMNLLTGAFAQNDSSRTMLIQVGANMDQNKQIFIGNMTASALGLQNAQGVNSFLSITTPEEANQAIGTLDAALKMVSKQRADLGGYQNRFEIAAQGVSIAAENLQAAESRIRDADMASEMVRYTKDSILTQAGGAMLAQANVRNQSVLQLLG
Sample Types
Isolate
3.3%
Metagenome
84.7%
MAG
0.0%
Metatranscriptome
12.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.1%
Kalotermitidae
23.2%
Unclassified
8.9%
Termopsidae
5.4%
Rhinotermitidae
3.6%
Blaberidae
1.8%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 38 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 49 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 52 | 3300021218 | Termite gut microbial communities from nest from French Guiana - FG16_L2_4 mRNA SA | Metatranscriptome | |
| 53 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 54 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 58 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_208003 | 3300042624 | Bacteria | 1577 |
| 2 | Ga0466704_486144 | 3300042643 | Bacteria | 2667 |
| 3 | Ga0466708_190888 | 3300042652 | Bacteria | 2457 |
| 4 | Ga0466718_135682 | 3300042617 | Unclassified | 1876 |
| 5 | Ga0223686_1002060 | 3300021244 | Bacteria | 936 |
| 6 | Ga0255809_1000370 | 3300022820 | Bacteria | 2577 |
| 7 | Ga0466696_461087 | 3300042596 | Bacteria | 17228 |
| 8 | Ga0466699_206842 | 3300042597 | Bacteria | 1215 |
| 9 | Ga0123353_10189443 | 3300010167 | Bacteria | 3248 |
| 10 | Ga0123354_10245220 | 3300010882 | Bacteria | 1832 |
| 11 | Ga0466719_313049 | 3300042606 | Bacteria | 2399 |
| 12 | Ga0466722_123856 | 3300042609 | Bacteria | 2836 |
| 13 | Ga0466698_008169 | 3300042610 | Bacteria | 1976 |
| 14 | AustNasuHG_c1014461 | 3300000089 | Bacteria | 2682 |
| 15 | JGI24695J34938_10038278 | 3300002450 | Bacteria | 2173 |
| 16 | JGI24700J35501_10930894 | 3300002508 | Bacteria | 35744 |
| 17 | Ga0072941_1035711 | 3300005201 | Bacteria | 13945 |
| 18 | Ga0466732_032935 | 3300042656 | Bacteria | 1382 |
| 19 | Ga0466703_398003 | 3300042636 | Bacteria | 19717 |
| 20 | Ga0466709_129614 | 3300042648 | Bacteria | 4143 |
| 21 | Ga0466708_214798 | 3300042652 | Bacteria | 2007 |
| 22 | Ga0466727_081506 | 3300042655 | Bacteria | 4585 |
| 23 | Ga0466715_264644 | 3300042616 | Bacteria | 13921 |
| 24 | Ga0233288_1000947 | 3300022232 | Bacteria | 2018 |
| 25 | Ga0255786_1000227 | 3300022815 | Bacteria | 2954 |
| 26 | Ga0466694_252753 | 3300042594 | Bacteria | 21663 |
| 27 | Ga0466694_333809 | 3300042594 | Bacteria | 4278 |
| 28 | Ga0123354_10231132 | 3300010882 | Bacteria | 1933 |
| 29 | Ga0466700_050865 | 3300042600 | Bacteria | 1102 |
| 30 | Ga0466717_226729 | 3300042604 | Bacteria | 1734 |
| 31 | Ga0466717_256804 | 3300042604 | Bacteria | 1940 |
| 32 | Ga0466719_108862 | 3300042606 | Unclassified | 2041 |
| 33 | Ga0466719_489562 | 3300042606 | Bacteria | 6710 |
| 34 | Ga0466735_071443 | 3300042624 | Bacteria | 4220 |
| 35 | Ga0466735_100953 | 3300042624 | Bacteria | 12211 |
| 36 | Ga0466702_351186 | 3300042635 | Bacteria | 2106 |
| 37 | Ga0466704_051526 | 3300042643 | Unclassified | 5687 |
| 38 | Ga0466708_181832 | 3300042652 | Bacteria | 35126 |
| 39 | Ga0466705_423122 | 3300042612 | Bacteria | 14947 |
| 40 | Ga0466718_085167 | 3300042617 | Bacteria | 24752 |
| 41 | Ga0466723_115494 | 3300042618 | Bacteria | 8909 |
| 42 | Ga0223679_100790 | 3300021218 | Bacteria | 919 |
| 43 | Ga0223674_1000633 | 3300021235 | Unclassified | 2010 |
| 44 | Ga0255786_1000495 | 3300022815 | Bacteria | 1161 |
| 45 | Ga0255786_1001103 | 3300022815 | Bacteria | 1697 |
| 46 | Ga0466693_048613 | 3300042592 | Bacteria | 20414 |
| 47 | Ga0123356_10873711 | 3300010049 | Bacteria | 1070 |
| 48 | Ga0466722_223274 | 3300042609 | Bacteria | 2491 |
| 49 | Ga0466729_289848 | 3300042621 | Bacteria | 1644 |
| 50 | Ga0466735_201081 | 3300042624 | Bacteria | 14757 |
| 51 | Ga0466702_165914 | 3300042635 | Bacteria | 1291 |
| 52 | Ga0466712_048812 | 3300042614 | Bacteria | 2609 |
| 53 | Ga0466712_265048 | 3300042614 | Unclassified | 1342 |
| 54 | Ga0223687_101077 | 3300021217 | Bacteria | 2099 |
| 55 | Ga0255786_1001094 | 3300022815 | Bacteria | 1932 |
| 56 | Ga0466691_196349 | 3300042593 | Bacteria | 25666 |
| 57 | Ga0123355_10817556 | 3300009826 | Bacteria | 1034 |
| 58 | Ga0466721_287796 | 3300042608 | Bacteria | 1142 |
| 59 | AustNasuHG_c1000346 | 3300000089 | Bacteria | 16163 |
| 60 | AustNasuHG_c1000682 | 3300000089 | Bacteria | 12071 |
| 61 | Ga0466705_339037 | 3300042612 | Bacteria | 3968 |
| 62 | Ga0466731_093728 | 3300042622 | Bacteria | 1531 |
| 63 | Ga0466703_149006 | 3300042636 | Bacteria | 17297 |
| 64 | Ga0466703_412533 | 3300042636 | Unclassified | 4758 |
| 65 | Ga0466708_226192 | 3300042652 | Bacteria | 21675 |
| 66 | Ga0466715_492663 | 3300042616 | Bacteria | 15278 |
| 67 | Ga0466718_047698 | 3300042617 | Bacteria | 18884 |
| 68 | Ga0466718_142433 | 3300042617 | Unclassified | 1300 |
| 69 | Ga0223679_100926 | 3300021218 | Bacteria | 952 |
| 70 | Ga0223674_1001726 | 3300021235 | Bacteria | 1979 |
| 71 | Ga0255786_1001308 | 3300022815 | Bacteria | 939 |
| 72 | Ga0255786_1002071 | 3300022815 | Unclassified | 983 |
| 73 | Ga0466694_211860 | 3300042594 | Bacteria | 2212 |
| 74 | Ga0466695_301352 | 3300042595 | Bacteria | 3594 |
| 75 | Ga0123353_10096312 | 3300010167 | Bacteria | 4769 |
| 76 | Ga0466716_178023 | 3300042605 | Bacteria | 7299 |
| 77 | Ga0466719_313249 | 3300042606 | Bacteria | 3266 |
| 78 | Ga0466698_102468 | 3300042610 | Bacteria | 2452 |
| 79 | Ga0466698_372179 | 3300042610 | Bacteria | 1164 |
| 80 | AustNasuHG_c1003780 | 3300000089 | Bacteria | 5461 |
| 81 | JGI24698J34947_10051142 | 3300002449 | Bacteria | 2080 |
| 82 | JGI24702J35022_10077557 | 3300002462 | Bacteria | 1797 |
| 83 | Ga0072941_1007276 | 3300005201 | Bacteria | 15345 |
| 84 | Ga0466705_098165 | 3300042612 | Bacteria | 9203 |
| 85 | Ga0466705_361905 | 3300042612 | Bacteria | 24780 |
| 86 | Ga0466734_085556 | 3300042623 | Bacteria | 1152 |
| 87 | Ga0466703_076898 | 3300042636 | Bacteria | 76177 |
| 88 | Ga0466704_419173 | 3300042643 | Bacteria | 2223 |
| 89 | Ga0466708_015661 | 3300042652 | Bacteria | 2648 |
| 90 | Ga0466718_122233 | 3300042617 | Bacteria | 1404 |
| 91 | Ga0466723_203557 | 3300042618 | Unclassified | 2334 |
| 92 | Ga0466723_347993 | 3300042618 | Bacteria | 25507 |
| 93 | Ga0255786_1000489 | 3300022815 | Bacteria | 1086 |
| 94 | Ga0466690_302574 | 3300042590 | Bacteria | 1633 |
| 95 | Ga0466691_065133 | 3300042593 | Bacteria | 8976 |
| 96 | Ga0466694_043554 | 3300042594 | Bacteria | 14346 |
| 97 | Ga0466694_066992 | 3300042594 | Bacteria | 3421 |
| 98 | Ga0466695_125495 | 3300042595 | Bacteria | 1238 |
| 99 | Ga0123356_10247254 | 3300010049 | Bacteria | 1859 |
| 100 | Ga0466722_082964 | 3300042609 | Bacteria | 56291 |
| 101 | Ga0466722_122656 | 3300042609 | Bacteria | 3825 |
| 102 | Ga0466722_230038 | 3300042609 | Bacteria | 10642 |
| 103 | Ga0466698_202139 | 3300042610 | Bacteria | 1420 |
| 104 | JGI24695J34938_10004595 | 3300002450 | Bacteria | 8981 |
| 105 | JGI24695J34938_10042576 | 3300002450 | Bacteria | 2031 |
| 106 | JGI24702J35022_10028063 | 3300002462 | Unclassified | 3027 |
| 107 | Ga0072941_1001996 | 3300005201 | Bacteria | 50262 |
| 108 | Ga0466735_135555 | 3300042624 | Bacteria | 2737 |
| 109 | Ga0466709_244765 | 3300042648 | Bacteria | 5902 |
| 110 | Ga0466727_065976 | 3300042655 | Bacteria | 2228 |
| 111 | Ga0466712_231924 | 3300042614 | Unclassified | 7011 |
| 112 | Ga0466718_029019 | 3300042617 | Bacteria | 14475 |
| 113 | Ga0466718_167744 | 3300042617 | Bacteria | 22582 |
| 114 | Ga0466726_477887 | 3300042619 | Bacteria | 9315 |
| 115 | Ga0223674_1000124 | 3300021235 | Unclassified | 1642 |
| 116 | Ga0223674_1000241 | 3300021235 | Bacteria | 1305 |
| 117 | Ga0255786_1001540 | 3300022815 | Bacteria | 2397 |
| 118 | Ga0466690_330451 | 3300042590 | Bacteria | 8064 |
| 119 | Ga0466694_202338 | 3300042594 | Bacteria | 1648 |
| 120 | Ga0466695_157336 | 3300042595 | Bacteria | 5916 |
| 121 | Ga0466699_063680 | 3300042597 | Bacteria | 13141 |
| 122 | Ga0466701_011100 | 3300042598 | Bacteria | 1031 |
| 123 | Ga0123356_10001011 | 3300010049 | Bacteria | 31243 |
| 124 | Ga0466700_378189 | 3300042600 | Bacteria | 1107 |
| 125 | Ga0466700_452737 | 3300042600 | Bacteria | 1441 |
| 126 | Ga0466707_116587 | 3300042601 | Bacteria | 2454 |
| 127 | Ga0466716_373002 | 3300042605 | Bacteria | 1031 |
| 128 | AustNasuHG_c1023753 | 3300000089 | Bacteria | 1952 |
| 129 | JGI24698J34947_10040137 | 3300002449 | Bacteria | 2419 |
| 130 | Ga0466732_037401 | 3300042656 | Bacteria | 1164 |
| 131 | Ga0466735_115890 | 3300042624 | Bacteria | 2006 |
| 132 | Ga0466708_177069 | 3300042652 | Unclassified | 5451 |
| 133 | Ga0466711_082703 | 3300042615 | Bacteria | 6691 |
| 134 | Ga0466715_001682 | 3300042616 | Bacteria | 16315 |
| 135 | Ga0466715_597372 | 3300042616 | Unclassified | 2909 |
| 136 | Ga0466723_334073 | 3300042618 | Bacteria | 4508 |
| 137 | Ga0466691_227837 | 3300042593 | Unclassified | 4294 |
| 138 | Ga0466694_000850 | 3300042594 | Bacteria | 4615 |
| 139 | Ga0466694_279672 | 3300042594 | Bacteria | 2830 |
| 140 | Ga0123357_10132973 | 3300009784 | Bacteria | 3088 |
| 141 | Ga0466719_007852 | 3300042606 | Bacteria | 11892 |
| 142 | Ga0466720_039312 | 3300042607 | Bacteria | 1556 |
| 143 | JGI24702J35022_10017464 | 3300002462 | Bacteria | 3919 |
| 144 | Ga0072941_1015195 | 3300005201 | Bacteria | 11371 |
| 145 | Ga0074263_116738 | 3300005485 | Bacteria | 1546 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042636 | Ga0466703_149006 | Ga0466703_149006_7682_8506 | 245 |
| 2 | 3300042635 | Ga0466702_351186 | Ga0466702_351186_1186_2034 | 260 |
| 3 | 3300002508 | JGI24700J35501_10930894 | JGI24700J35501_1093089412 | 267 |
| 4 | 3300042612 | Ga0466705_423122 | Ga0466705_423122_9213_10037 | 269 |
| 5 | 3300042624 | Ga0466735_071443 | Ga0466735_071443_619_1488 | 270 |
| 6 | 3300002450 | JGI24695J34938_10004595 | JGI24695J34938_100045954 | 275 |
| 7 | 3300042594 | Ga0466694_252753 | Ga0466694_252753_9278_10111 | 277 |
| 8 | 3300022815 | Ga0255786_1000489 | Ga0255786_10004891 | 278 |
| 9 | 3300042594 | Ga0466694_202338 | Ga0466694_202338_399_1235 | 278 |
| 10 | 3300042609 | Ga0466722_230038 | Ga0466722_230038_10_846 | 278 |
| 11 | 3300042618 | Ga0466723_115494 | Ga0466723_115494_401_1255 | 278 |
| 12 | 3300042655 | Ga0466727_081506 | Ga0466727_081506_810_1664 | 278 |
| 13 | 3300042592 | Ga0466693_048613 | Ga0466693_048613_154_1008 | 279 |
| 14 | 3300042624 | Ga0466735_201081 | Ga0466735_201081_3691_4533 | 280 |
| 15 | 3300042600 | Ga0466700_452737 | Ga0466700_452737_144_989 | 281 |
| 16 | 3300021218 | Ga0223679_100790 | Ga0223679_1007901 | 282 |
| 17 | 3300002449 | JGI24698J34947_10051142 | JGI24698J34947_100511422 | 284 |
| 18 | 3300021218 | Ga0223679_100926 | Ga0223679_1009262 | 284 |
| 19 | 3300021235 | Ga0223674_1000124 | Ga0223674_10001242 | 284 |
| 20 | 3300021235 | Ga0223674_1000633 | Ga0223674_10006332 | 284 |
| 21 | 3300021235 | Ga0223674_1001726 | Ga0223674_10017262 | 284 |
| 22 | 3300021244 | Ga0223686_1002060 | Ga0223686_10020601 | 284 |
| 23 | 3300022232 | Ga0233288_1000947 | Ga0233288_10009472 | 284 |
| 24 | 3300022815 | Ga0255786_1000227 | Ga0255786_10002272 | 284 |
| 25 | 3300022815 | Ga0255786_1000495 | Ga0255786_10004951 | 284 |
| 26 | 3300022815 | Ga0255786_1001094 | Ga0255786_10010941 | 284 |
| 27 | 3300022815 | Ga0255786_1001103 | Ga0255786_10011031 | 284 |
| 28 | 3300022815 | Ga0255786_1001308 | Ga0255786_10013081 | 284 |
| 29 | 3300022815 | Ga0255786_1001540 | Ga0255786_10015402 | 284 |
| 30 | 3300022815 | Ga0255786_1002071 | Ga0255786_10020711 | 284 |
| 31 | 3300022820 | Ga0255809_1000370 | Ga0255809_10003702 | 284 |
| 32 | 3300042590 | Ga0466690_330451 | Ga0466690_330451_2373_3227 | 284 |
| 33 | 3300042593 | Ga0466691_065133 | Ga0466691_065133_1738_2592 | 284 |
| 34 | 3300042593 | Ga0466691_227837 | Ga0466691_227837_1191_2045 | 284 |
| 35 | 3300042594 | Ga0466694_000850 | Ga0466694_000850_2180_3034 | 284 |
| 36 | 3300042594 | Ga0466694_043554 | Ga0466694_043554_5848_6702 | 284 |
| 37 | 3300042594 | Ga0466694_066992 | Ga0466694_066992_748_1602 | 284 |
| 38 | 3300042594 | Ga0466694_211860 | Ga0466694_211860_448_1302 | 284 |
| 39 | 3300042594 | Ga0466694_279672 | Ga0466694_279672_300_1154 | 284 |
| 40 | 3300042594 | Ga0466694_333809 | Ga0466694_333809_1465_2319 | 284 |
| 41 | 3300042595 | Ga0466695_125495 | Ga0466695_125495_209_1063 | 284 |
| 42 | 3300042595 | Ga0466695_157336 | Ga0466695_157336_4349_5203 | 284 |
| 43 | 3300042595 | Ga0466695_301352 | Ga0466695_301352_689_1543 | 284 |
| 44 | 3300042596 | Ga0466696_461087 | Ga0466696_461087_11029_11883 | 284 |
| 45 | 3300042598 | Ga0466701_011100 | Ga0466701_011100_39_893 | 284 |
| 46 | 3300042600 | Ga0466700_050865 | Ga0466700_050865_106_960 | 284 |
| 47 | 3300042601 | Ga0466707_116587 | Ga0466707_116587_483_1337 | 284 |
| 48 | 3300042604 | Ga0466717_226729 | Ga0466717_226729_112_966 | 284 |
| 49 | 3300042604 | Ga0466717_256804 | Ga0466717_256804_98_952 | 284 |
| 50 | 3300042606 | Ga0466719_108862 | Ga0466719_108862_720_1574 | 284 |
| 51 | 3300042606 | Ga0466719_489562 | Ga0466719_489562_3652_4506 | 284 |
| 52 | 3300042607 | Ga0466720_039312 | Ga0466720_039312_466_1320 | 284 |
| 53 | 3300042608 | Ga0466721_287796 | Ga0466721_287796_248_1102 | 284 |
| 54 | 3300042609 | Ga0466722_082964 | Ga0466722_082964_54164_55018 | 284 |
| 55 | 3300042609 | Ga0466722_122656 | Ga0466722_122656_1467_2321 | 284 |
| 56 | 3300042610 | Ga0466698_008169 | Ga0466698_008169_255_1109 | 284 |
| 57 | 3300042610 | Ga0466698_102468 | Ga0466698_102468_407_1261 | 284 |
| 58 | 3300042610 | Ga0466698_372179 | Ga0466698_372179_191_1045 | 284 |
| 59 | 3300042612 | Ga0466705_098165 | Ga0466705_098165_4735_5589 | 284 |
| 60 | 3300042614 | Ga0466712_048812 | Ga0466712_048812_1230_2084 | 284 |
| 61 | 3300042614 | Ga0466712_231924 | Ga0466712_231924_494_1348 | 284 |
| 62 | 3300042614 | Ga0466712_265048 | Ga0466712_265048_226_1080 | 284 |
| 63 | 3300042615 | Ga0466711_082703 | Ga0466711_082703_3073_3927 | 284 |
| 64 | 3300042616 | Ga0466715_001682 | Ga0466715_001682_9368_10222 | 284 |
| 65 | 3300042616 | Ga0466715_264644 | Ga0466715_264644_7389_8243 | 284 |
| 66 | 3300042616 | Ga0466715_597372 | Ga0466715_597372_410_1264 | 284 |
| 67 | 3300042617 | Ga0466718_047698 | Ga0466718_047698_16662_17516 | 284 |
| 68 | 3300042617 | Ga0466718_085167 | Ga0466718_085167_22114_22968 | 284 |
| 69 | 3300042617 | Ga0466718_122233 | Ga0466718_122233_207_1061 | 284 |
| 70 | 3300042617 | Ga0466718_135682 | Ga0466718_135682_771_1625 | 284 |
| 71 | 3300042618 | Ga0466723_347993 | Ga0466723_347993_12484_13338 | 284 |
| 72 | 3300042619 | Ga0466726_477887 | Ga0466726_477887_5868_6722 | 284 |
| 73 | 3300042621 | Ga0466729_289848 | Ga0466729_289848_176_1030 | 284 |
| 74 | 3300042622 | Ga0466731_093728 | Ga0466731_093728_249_1103 | 284 |
| 75 | 3300042623 | Ga0466734_085556 | Ga0466734_085556_92_946 | 284 |
| 76 | 3300042624 | Ga0466735_100953 | Ga0466735_100953_2071_2925 | 284 |
| 77 | 3300042624 | Ga0466735_115890 | Ga0466735_115890_266_1120 | 284 |
| 78 | 3300042624 | Ga0466735_135555 | Ga0466735_135555_1548_2402 | 284 |
| 79 | 3300042635 | Ga0466702_165914 | Ga0466702_165914_208_1062 | 284 |
| 80 | 3300042636 | Ga0466703_398003 | Ga0466703_398003_4836_5690 | 284 |
| 81 | 3300042636 | Ga0466703_412533 | Ga0466703_412533_1067_1921 | 284 |
| 82 | 3300042648 | Ga0466709_244765 | Ga0466709_244765_76_930 | 284 |
| 83 | 3300042652 | Ga0466708_177069 | Ga0466708_177069_55_909 | 284 |
| 84 | 3300042652 | Ga0466708_214798 | Ga0466708_214798_1112_1966 | 284 |
| 85 | 3300042655 | Ga0466727_065976 | Ga0466727_065976_1117_1971 | 284 |
| 86 | 3300042656 | Ga0466732_032935 | Ga0466732_032935_65_919 | 284 |
| 87 | 3300042656 | Ga0466732_037401 | Ga0466732_037401_282_1136 | 284 |
| 88 | iso_pr_bacteria | 2772190975 | 2773723569 | 284 |
| 89 | iso_pr_bacteria | 2772190978 | 2773730545 | 284 |
| 90 | iso_pr_bacteria | 2781125629 | 2781263860 | 284 |
| 91 | iso_pr_bacteria | 2781125630 | 2781266733 | 284 |
| 92 | iso_pr_bacteria | 2781125697 | 2781443617 | 284 |
| 93 | 3300000089 | AustNasuHG_c1000346 | AustNasuHG_10003463 | 285 |
| 94 | 3300000089 | AustNasuHG_c1000682 | AustNasuHG_10006826 | 285 |
| 95 | 3300000089 | AustNasuHG_c1003780 | AustNasuHG_10037804 | 285 |
| 96 | 3300000089 | AustNasuHG_c1014461 | AustNasuHG_10144612 | 285 |
| 97 | 3300000089 | AustNasuHG_c1023753 | AustNasuHG_10237532 | 285 |
| 98 | 3300002449 | JGI24698J34947_10040137 | JGI24698J34947_100401373 | 285 |
| 99 | 3300002450 | JGI24695J34938_10038278 | JGI24695J34938_100382782 | 285 |
| 100 | 3300002462 | JGI24702J35022_10017464 | JGI24702J35022_100174641 | 285 |
| 101 | 3300002462 | JGI24702J35022_10028063 | JGI24702J35022_100280634 | 285 |
| 102 | 3300002462 | JGI24702J35022_10077557 | JGI24702J35022_100775571 | 285 |
| 103 | 3300005201 | Ga0072941_1001996 | Ga0072941_10019961 | 285 |
| 104 | 3300005201 | Ga0072941_1007276 | Ga0072941_100727621 | 285 |
| 105 | 3300005201 | Ga0072941_1015195 | Ga0072941_10151952 | 285 |
| 106 | 3300005201 | Ga0072941_1035711 | Ga0072941_103571114 | 285 |
| 107 | 3300005485 | Ga0074263_116738 | Ga0074263_1167381 | 285 |
| 108 | 3300009784 | Ga0123357_10132973 | Ga0123357_101329731 | 285 |
| 109 | 3300010049 | Ga0123356_10247254 | Ga0123356_102472542 | 285 |
| 110 | 3300010049 | Ga0123356_10873711 | Ga0123356_108737112 | 285 |
| 111 | 3300010167 | Ga0123353_10096312 | Ga0123353_100963123 | 285 |
| 112 | 3300010167 | Ga0123353_10189443 | Ga0123353_101894432 | 285 |
| 113 | 3300010882 | Ga0123354_10231132 | Ga0123354_102311322 | 285 |
| 114 | 3300010882 | Ga0123354_10245220 | Ga0123354_102452202 | 285 |
| 115 | 3300042600 | Ga0466700_378189 | Ga0466700_378189_81_938 | 285 |
| 116 | 3300042605 | Ga0466716_178023 | Ga0466716_178023_4437_5294 | 285 |
| 117 | 3300042652 | Ga0466708_181832 | Ga0466708_181832_6777_7634 | 285 |
| 118 | 3300002450 | JGI24695J34938_10042576 | JGI24695J34938_100425761 | 286 |
| 119 | 3300042593 | Ga0466691_196349 | Ga0466691_196349_18612_19472 | 286 |
| 120 | 3300042597 | Ga0466699_206842 | Ga0466699_206842_173_1033 | 286 |
| 121 | 3300009826 | Ga0123355_10817556 | Ga0123355_108175561 | 287 |
| 122 | 3300042590 | Ga0466690_302574 | Ga0466690_302574_52_918 | 288 |
| 123 | 3300042605 | Ga0466716_373002 | Ga0466716_373002_124_990 | 288 |
| 124 | 3300042606 | Ga0466719_313049 | Ga0466719_313049_675_1541 | 288 |
| 125 | 3300042606 | Ga0466719_313249 | Ga0466719_313249_538_1404 | 288 |
| 126 | 3300042609 | Ga0466722_123856 | Ga0466722_123856_89_955 | 288 |
| 127 | 3300042609 | Ga0466722_223274 | Ga0466722_223274_1368_2234 | 288 |
| 128 | 3300042612 | Ga0466705_339037 | Ga0466705_339037_3018_3884 | 288 |
| 129 | 3300042624 | Ga0466735_208003 | Ga0466735_208003_646_1512 | 288 |
| 130 | 3300042643 | Ga0466704_051526 | Ga0466704_051526_3858_4724 | 288 |
| 131 | 3300042643 | Ga0466704_486144 | Ga0466704_486144_822_1688 | 288 |
| 132 | 3300042606 | Ga0466719_007852 | Ga0466719_007852_383_1252 | 289 |
| 133 | 3300042616 | Ga0466715_492663 | Ga0466715_492663_10239_11108 | 289 |
| 134 | 3300042617 | Ga0466718_029019 | Ga0466718_029019_12431_13300 | 289 |
| 135 | 3300042617 | Ga0466718_142433 | Ga0466718_142433_96_965 | 289 |
| 136 | 3300042617 | Ga0466718_167744 | Ga0466718_167744_1167_2036 | 289 |
| 137 | 3300042652 | Ga0466708_226192 | Ga0466708_226192_12512_13381 | 289 |
| 138 | 3300042636 | Ga0466703_076898 | Ga0466703_076898_26731_27660 | 293 |
| 139 | 3300042618 | Ga0466723_203557 | Ga0466723_203557_642_1529 | 295 |
| 140 | 3300042643 | Ga0466704_419173 | Ga0466704_419173_1026_1913 | 295 |
| 141 | 3300042648 | Ga0466709_129614 | Ga0466709_129614_1819_2706 | 295 |
| 142 | 3300042652 | Ga0466708_190888 | Ga0466708_190888_802_1689 | 295 |
| 143 | 3300042612 | Ga0466705_361905 | Ga0466705_361905_9070_9960 | 296 |
| 144 | 3300042652 | Ga0466708_015661 | Ga0466708_015661_614_1525 | 303 |
| 145 | 3300021235 | Ga0223674_1000241 | Ga0223674_10002411 | 314 |
| 146 | 3300042610 | Ga0466698_202139 | Ga0466698_202139_271_1218 | 315 |
| 147 | 3300042597 | Ga0466699_063680 | Ga0466699_063680_9890_10849 | 319 |
| 148 | 3300042618 | Ga0466723_334073 | Ga0466723_334073_2909_3886 | 325 |
| 149 | 3300021217 | Ga0223687_101077 | Ga0223687_1010774 | 355 |
| 150 | 3300010049 | Ga0123356_10001011 | Ga0123356_1000101111 | 366 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00669 | GO:0005198 | structural molecule activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.59 | 0.71 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.