Protein Family IF04052
Metagenome
Isolate
347
Members
318
Samples
71
Scaffolds
169.07
Avg Length
Representative Sequence
- ID
- 3300012854|Ga0160448_100015|Ga0160448_10001519
- Length
- 196 aa
- Sequence
- MNSPAWYTLVDFRPKKGAQYTVFHRESLMSSLIYLQGYPEPILEQVHTLIEHQRLGTFLQERYPDTHNVISDKALYDFTQSLKNRFMRNAPPISKVIWDNKIKVMKHALGLHTAISRVQGGNLKAKAEIRISTFFRMAPEPFLRMIVVHELAHLKEKEHDKAFYQLCCHMEPDYHQLEFDARLWMTDQAMRGNAA*
Sample Types
Isolate
79.5%
Metagenome
20.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.3%
Coreidae
26.0%
Drosophilidae
5.5%
Anthocoridae
4.5%
Culicidae
4.2%
Muscidae
4.2%
Curculionidae
4.2%
Elmidae
2.6%
Calliphoridae
2.3%
Tenebrionidae
2.3%
Armadillidiidae
1.6%
Cerambycidae
1.0%
Apidae
1.0%
Talitridae
1.0%
Palinuridae
1.0%
Formicidae
1.0%
Tephritidae
1.0%
Aphididae
0.6%
Sarcophagidae
0.6%
Passalidae
0.6%
Pentatomidae
0.6%
Berytidae
0.6%
Termitidae
0.6%
Majidae
0.6%
Alydidae
0.6%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Nephropidae
0.3%
Siricidae
0.3%
Crambidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Plutellidae
0.3%
Glossinidae
0.3%
Carabidae
0.3%
Cixiidae
0.3%
Daphniidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Artemiidae
0.3%
Taxonomy
Archaea
0
Bacteria
318
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 3 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 4 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 5 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 6 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 7 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 8 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 9 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 10 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 11 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 12 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 13 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 14 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 15 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 16 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 17 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 18 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 19 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 20 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 21 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 22 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 23 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 24 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 25 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 26 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 27 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 28 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 29 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 30 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 31 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 32 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 33 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 34 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 35 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 36 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 37 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 38 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 39 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 40 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 41 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 42 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 43 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 44 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 45 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 46 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 47 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 48 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 49 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 50 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 53 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 54 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 55 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 56 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 57 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 58 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 59 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 60 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 61 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 62 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 63 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 64 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 65 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 66 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 67 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 68 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 69 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 70 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 71 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 72 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 73 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 74 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 75 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 76 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 77 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 78 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 79 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 80 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 81 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 82 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 83 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 84 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 85 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 86 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 87 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 88 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 89 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 90 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 91 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 92 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 93 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 94 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 95 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 96 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 97 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 98 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 99 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 100 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 101 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 102 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 103 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 104 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 105 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 106 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 107 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 108 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 109 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 110 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 111 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 112 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 113 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 114 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 115 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 116 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 117 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 118 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 119 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 120 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 121 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 122 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 123 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 124 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 125 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 126 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 127 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 128 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 129 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 130 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 131 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 132 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 133 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 134 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 135 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 136 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 137 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 138 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 139 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 140 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 141 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 142 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 143 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 144 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 145 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 146 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 147 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 148 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 149 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 150 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 151 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 152 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 153 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 154 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 155 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 156 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 157 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 158 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 159 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 160 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 161 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 162 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 163 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 164 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 165 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 166 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 167 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 168 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 169 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 170 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 171 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 172 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 173 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 174 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 175 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 176 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 177 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 178 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 179 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 180 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 181 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 182 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 183 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 184 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 185 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 186 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 187 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 188 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 189 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 190 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 191 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 192 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 193 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 194 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 195 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 196 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 197 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 198 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 199 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 200 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 201 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 202 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 203 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 204 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 205 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 206 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 207 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 208 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 209 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 210 | 2958255616 | Serratia marcescens TM | Isolate | |
| 211 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 212 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 213 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 214 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 215 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 216 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 217 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 218 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 219 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 220 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 221 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 222 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 223 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 224 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 225 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 226 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 227 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 228 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 229 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 230 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 231 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 232 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 233 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 234 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 235 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 236 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 237 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 238 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 239 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 240 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 241 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 242 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 243 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 244 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 245 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 246 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 247 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 248 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 249 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 250 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 251 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 252 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 253 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 254 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 255 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 256 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 257 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 258 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 259 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 260 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 261 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 262 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 263 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 264 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 265 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 266 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 267 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 268 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 269 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 270 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 271 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 272 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 273 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 274 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 275 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 276 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 277 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 278 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 279 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 280 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 281 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 282 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 283 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 284 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 285 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 286 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 287 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 288 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 289 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 290 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 291 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 292 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 293 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 294 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 295 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 296 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 297 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 298 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 299 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 300 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 301 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 302 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 303 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 304 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 305 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 306 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 307 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 308 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 309 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 310 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 311 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 312 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 313 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 314 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 315 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 316 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 317 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 318 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160466_101442 | 3300012809 | Bacteria | 6451 |
| 2 | SWWA_contig31643__length_39767___numreads_2414 | 2100351016 | Bacteria | 39767 |
| 3 | SWWA_contig31970__length_3180___numreads_52 | 2100351016 | Bacteria | 3180 |
| 4 | Ga0104051_1102437 | 3300007078 | Unclassified | 2010 |
| 5 | Ga0104040_1147335 | 3300007149 | Bacteria | 1410 |
| 6 | Ga0105005_1286178 | 3300007505 | Bacteria | 1580 |
| 7 | Ga0160436_1039274 | 3300012861 | Bacteria | 757 |
| 8 | Ga0466724_06282 | 3300042649 | Unclassified | 3488 |
| 9 | DPO_contig08248 | 2032320009 | Bacteria | 129472 |
| 10 | Ga0104049_1132087 | 3300007103 | Bacteria | 1905 |
| 11 | Ga0104019_1199236 | 3300007150 | Bacteria | 980 |
| 12 | Ga0160455_107793 | 3300012837 | Unclassified | 1031 |
| 13 | Ga0265387_1000018 | 3300024582 | Bacteria | 70381 |
| 14 | Ga0466730_015341 | 3300042625 | Unclassified | 9169 |
| 15 | Ga0466730_034247 | 3300042625 | Bacteria | 2089 |
| 16 | Ga0466730_093620 | 3300042625 | Unclassified | 1198 |
| 17 | IMNBL1DRAFT_c0000668 | 3300000062 | Bacteria | 27473 |
| 18 | Ga0074188_1000742 | 3300005318 | Bacteria | 12374 |
| 19 | Ga0160433_101496 | 3300012846 | Unclassified | 6338 |
| 20 | Ga0160435_1001065 | 3300012857 | Bacteria | 7226 |
| 21 | DPO_contig00083 | 2032320009 | Bacteria | 42882 |
| 22 | FGTW_contig14014 | 2065487013 | Bacteria | 1003 |
| 23 | Ga0063521_1000065 | 3300003973 | Bacteria | 90440 |
| 24 | Ga0104051_1102228 | 3300007078 | Unclassified | 2214 |
| 25 | Ga0160468_109565 | 3300012819 | Bacteria | 956 |
| 26 | Ga0160448_100015 | 3300012854 | Bacteria | 249908 |
| 27 | Ga0316159_11919 | 3300030930 | Unclassified | 2441 |
| 28 | Ga0562379_0007 | 3300056790 | Bacteria | 2440168 |
| 29 | FGTW_contig30410 | 2065487013 | Bacteria | 89189 |
| 30 | FGTW_contig31557 | 2065487013 | Unclassified | 4046 |
| 31 | Meta3P_1000746 | 3300002464 | Unclassified | 11153 |
| 32 | Ga0063521_1000150 | 3300003973 | Bacteria | 52824 |
| 33 | Ga0104041_1035333 | 3300007106 | Unclassified | 4861 |
| 34 | Ga0104147_1022926 | 3300007224 | Bacteria | 7011 |
| 35 | Ga0105005_1039397 | 3300007505 | Bacteria | 5625 |
| 36 | Ga0160459_115974 | 3300012831 | Unclassified | 843 |
| 37 | Ga0247289_0246 | 3300035363 | Unclassified | 10876 |
| 38 | Ga0466730_003553 | 3300042625 | Bacteria | 13168 |
| 39 | Ga0466730_077726 | 3300042625 | Bacteria | 2899 |
| 40 | Ga0466724_66223 | 3300042649 | Bacteria | 15767 |
| 41 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 42 | Ga0160471_100502 | 3300012812 | Unclassified | 10723 |
| 43 | Ga0074188_1156036 | 3300005318 | Unclassified | 1842 |
| 44 | Ga0160468_100809 | 3300012819 | Unclassified | 10107 |
| 45 | Ga0160467_102854 | 3300012829 | Bacteria | 3340 |
| 46 | Ga0247289_1338 | 3300035363 | Unclassified | 2359 |
| 47 | Ga0466730_032525 | 3300042625 | Bacteria | 82619 |
| 48 | Ga0562378_0105 | 3300056814 | Bacteria | 222310 |
| 49 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 50 | SPBB_contig10651 | 2044078006 | Unclassified | 780 |
| 51 | FGTW_contig30920 | 2065487013 | Unclassified | 7441 |
| 52 | Meta3P_1000088 | 3300002464 | Bacteria | 51356 |
| 53 | CVPL010L_1002555 | 3300002932 | Unclassified | 2499 |
| 54 | Ga0105008_1215005 | 3300007507 | Bacteria | 2028 |
| 55 | Ga0160430_104577 | 3300012852 | Unclassified | 3389 |
| 56 | Ga0466707_093111 | 3300042601 | Unclassified | 1119 |
| 57 | Ga0466707_229655 | 3300042601 | Bacteria | 71770 |
| 58 | Ga0466713_003276 | 3300042602 | Unclassified | 62671 |
| 59 | Ga0466713_052554 | 3300042602 | Bacteria | 64110 |
| 60 | Ga0466713_144288 | 3300042602 | Bacteria | 9895 |
| 61 | Ga0466730_024159 | 3300042625 | Unclassified | 46360 |
| 62 | Ga0466730_103052 | 3300042625 | Bacteria | 36200 |
| 63 | DPOL_contig15727 | 2035918003 | Bacteria | 1601 |
| 64 | DPOL_contig17802 | 2035918003 | Bacteria | 1614 |
| 65 | SPBB_contig11568 | 2044078006 | Unclassified | 36788 |
| 66 | FGTW_contig31191 | 2065487013 | Unclassified | 5691 |
| 67 | 2227646824 | 2225789004 | Bacteria | 44077 |
| 68 | Ga0160460_100929 | 3300012845 | Unclassified | 12463 |
| 69 | Ga0160457_1000282 | 3300012858 | Bacteria | 32389 |
| 70 | Ga0316159_10985 | 3300030930 | Unclassified | 7501 |
| 71 | Ga0466724_33215 | 3300042649 | Unclassified | 2877 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01863 | YgjP-like | YgjP-like, metallopeptidase domain | 100 | 177 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.