Protein Family IF04018

Metagenome Isolate
274 Members
201 Samples
149 Scaffolds
231.22 Avg Length

🧬 Representative Sequence

ID
3300012849|Ga0160447_112318|Ga0160447_1123182
Length
212 aa
Sequence
MAKKGKKYVEAAKLVDRTQTYSVQAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDADYINKIQQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVQKAVNEIKAGKVEYRVDKAGNIHVPIGKVSFEESKLVENFTTIFETMVKAKPAAAKGTYMKNVAVTSTMGPGIKVDTASFSA*

πŸ“Š Sample Types

Isolate 45.6%
Metagenome 54.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 19.2%
Termitidae 15.4%
Apidae 10.4%
Kalotermitidae 7.1%
Blattidae 6.0%
Drosophilidae 4.4%
Tenebrionidae 4.4%
Formicidae 4.4%
Elmidae 3.8%
Scarabaeidae 3.8%
Pyralidae 2.7%
Rhinotermitidae 1.6%
Bombycidae 1.6%
Termopsidae 1.6%
Passalidae 1.1%
Noctuidae 1.1%
Culicidae 1.1%
Calliphoridae 0.5%
Vespidae 0.5%
Hodotermitidae 0.5%
Penaeidae 0.5%
Portunidae 0.5%
Curculionidae 0.5%
Libellulidae 0.5%
Hydrophilidae 0.5%
Eresidae 0.5%
Armadillidiidae 0.5%
Plutellidae 0.5%
Rhaphidophoridae 0.5%
Pyrrhocoridae 0.5%
Dytiscidae 0.5%
Ceratopogonidae 0.5%
Gomphidae 0.5%
Nephropidae 0.5%
Ocypodidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 259
Eukaryota 0
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
2 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
3 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
4 2864909992 Bacillus velezensis S00166 Isolate Elmidae
5 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
6 2595698199 Melissococcus plutonius 60 Isolate Apidae
7 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
13 8007237282 Enterococcus sp. DIV0212c Isolate
14 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
15 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
16 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
21 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
22 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
23 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
24 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
25 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
26 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
27 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
28 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
29 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
30 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
31 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
32 2595698193 Melissococcus plutonius B5 Isolate Apidae
33 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
34 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
35 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
36 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
37 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
38 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
39 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
40 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
41 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
42 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
43 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
44 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
48 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 8114555646 Enterococcus sp. DIV1094 Isolate
53 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
54 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
55 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
56 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
57 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
58 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
59 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
60 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
61 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
62 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
63 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
64 2627853628 Melissococcus plutonius 82 Isolate Apidae
65 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
66 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
67 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
68 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
69 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
70 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
71 8064008355 Heyndrickxia oleronia Isolate Unclassified
72 8082023105 Niallia sp. Man26 Isolate Penaeidae
73 2969145278 Bacillus cereus 29 Isolate Portunidae
74 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
75 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
76 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
77 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
78 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
79 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
80 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
81 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
82 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
83 2595698198 Melissococcus plutonius L9 Isolate Apidae
84 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
85 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
86 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
87 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
88 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
89 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
90 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
91 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
92 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
93 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
96 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
97 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
98 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
99 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
100 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
101 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
102 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
103 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
104 2864895409 Bacillus aerius S00152 Isolate Elmidae
105 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
106 2916858470 Heyndrickxia oleronia Isolate Unclassified
107 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
108 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
109 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
110 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
111 2595698197 Melissococcus plutonius H6 Isolate Apidae
112 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
113 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
114 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
115 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
116 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
117 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
118 8022725327 Bacillus sp. SN10 Isolate Eresidae
119 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
120 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
121 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
122 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
123 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
124 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
125 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
126 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
127 3300008519 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti Metagenome Formicidae
128 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
129 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
130 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
131 8112490586 Staphylococcus muscae CCM 4175 Isolate
132 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
133 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
134 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
135 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
136 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
137 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
138 2537562000 Bacillus cereus HD73 Isolate Pyralidae
139 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
140 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
141 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
142 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
143 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
144 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
145 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
146 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
147 8108568626 Enterococcus sp. DIV1094 Isolate
148 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
149 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
150 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
151 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
152 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
153 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
154 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
155 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
156 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
157 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
158 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
159 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
160 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
161 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
162 2864801025 Bacillus aerius S00042 Isolate Elmidae
163 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
164 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
165 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
166 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
167 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
168 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
169 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
170 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
171 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
172 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
173 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
174 2820871393 Unclassified Actinobacteria Lab288P3bin101 Isolate Unclassified
175 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
176 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
177 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
178 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
179 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
180 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
181 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
182 2595698195 Melissococcus plutonius 119 Isolate Apidae
183 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
184 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
185 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
186 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
187 8007223943 Enterococcus sp. MSG2901 Isolate
188 8012112996 Staphylococcus muscae ATCC 49910 Isolate
189 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
190 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
191 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
192 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
193 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
194 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
195 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
196 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
197 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
198 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
199 2978778678 Bacillus cereus 25 Isolate Ocypodidae
200 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
201 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0681 3300056790 Unclassified 57878
2 Ga0562376_1714 3300056857 Unclassified 29495
3 Ga0466715_042181 3300042616 Bacteria 63725
4 Ga0466726_065279 3300042619 Bacteria 58452
5 Ga0466707_262781 3300042601 Bacteria 9047
6 Ga0466707_278592 3300042601 Bacteria 154108
7 Ga0466719_522406 3300042606 Bacteria 1563
8 Ga0466719_523800 3300042606 Bacteria 8558
9 Ga0466722_236472 3300042609 Bacteria 4584
10 Ga0264413_162424 3300024493 Bacteria 1054
11 Ga0255576_1000225 3300026558 Bacteria 43604
12 Ga0466696_257695 3300042596 Bacteria 8158
13 Ga0123355_10068135 3300009826 Bacteria 5726
14 Ga0123355_10714063 3300009826 Bacteria 1146
15 Ga0123353_10002158 3300010167 Bacteria 24325
16 Ga0466697_064414 3300042611 Bacteria 1886
17 Ga0530661_000024 3300056564 Bacteria 185853
18 Ga0562378_0771 3300056814 Bacteria 44323
19 Ga0466723_145021 3300042618 Bacteria 26307
20 Ga0466706_096843 3300042599 Bacteria 3557
21 Ga0466700_383333 3300042600 Bacteria 8804
22 Ga0466716_300015 3300042605 Bacteria 3684
23 Ga0466719_471935 3300042606 Bacteria 42176
24 Ga0415639_038553 3300038395 Bacteria 3339
25 Ga0466691_004164 3300042593 Bacteria 33925
26 Ga0466694_036923 3300042594 Bacteria 3068
27 Ga0123356_10738237 3300010049 Unclassified 1154
28 Ga0160464_100835 3300012805 Bacteria 16383
29 2212886494 2209111004 Bacteria 8136
30 JGI24703J35330_11459859 3300002501 Bacteria 1046
31 JGI24697J35500_11213521 3300002507 Unclassified 1797
32 CVPL010L_1000369 3300002932 Unclassified 10726
33 Ga0466734_075033 3300042623 Bacteria 4664
34 Ga0466730_044605 3300042625 Bacteria 3445
35 Ga0466724_48958 3300042649 Bacteria 1228
36 Ga0466710_319995 3300042613 Bacteria 1337
37 Ga0466715_586554 3300042616 Bacteria 2830
38 Ga0466726_064906 3300042619 Bacteria 72682
39 Ga0466726_186614 3300042619 Bacteria 12966
40 Ga0466728_333581 3300042620 Bacteria 2672
41 Ga0466728_409986 3300042620 Bacteria 12278
42 Ga0466701_101169 3300042598 Bacteria 66668
43 Ga0466707_089502 3300042601 Bacteria 12032
44 Ga0466719_084719 3300042606 Bacteria 20043
45 Ga0415639_119748 3300038395 Bacteria 1266
46 Ga0466656_252214 3300042550 Bacteria 1128
47 Ga0466695_319579 3300042595 Bacteria 1338
48 Ga0123355_10033229 3300009826 Bacteria 8378
49 Ga0123356_11220452 3300010049 Bacteria 918
50 2227480184 2225789004 Bacteria 78831
51 2227563513 2225789004 Bacteria 51011
52 JGI24702J35022_10019717 3300002462 Bacteria 3667
53 JGI24696J40584_12957527 3300002834 Bacteria 3561
54 Ga0068302_10015215 3300005071 Bacteria 43393
55 Ga0072941_1418630 3300005201 Bacteria 1400
56 Ga0104019_1004266 3300007150 Bacteria 2758
57 Ga0466733_031080 3300042659 Bacteria 9171
58 Ga0562376_1810 3300056857 Unclassified 28502
59 Ga0466704_418643 3300042643 Bacteria 2951
60 Ga0466724_01144 3300042649 Bacteria 15535
61 Ga0466727_142534 3300042655 Bacteria 55597
62 Ga0466715_282602 3300042616 Bacteria 48405
63 Ga0466706_137549 3300042599 Bacteria 8681
64 Ga0466717_041744 3300042604 Bacteria 15696
65 Ga0415639_053171 3300038395 Bacteria 13877
66 Ga0123355_10217607 3300009826 Bacteria 2754
67 Ga0123356_10000572 3300010049 Bacteria 40906
68 Ga0123353_10045818 3300010167 Bacteria 6944
69 Ga0123353_10936190 3300010167 Unclassified 1174
70 Ga0123353_10978176 3300010167 Bacteria 1140
71 Ga0068302_10156818 3300005071 Bacteria 6463
72 Ga0072940_1147877 3300005200 Bacteria 2371
73 Ga0466705_110843 3300042612 Bacteria 6347
74 Ga0562379_1612 3300056790 Bacteria 24409
75 Ga0562379_4537 3300056790 Bacteria 6819
76 Ga0562377_0208 3300056842 Bacteria 150977
77 Ga0562375_0025 3300056856 Bacteria 749171
78 Ga0466734_109007 3300042623 Bacteria 5083
79 Ga0466703_106684 3300042636 Bacteria 7252
80 Ga0466704_327441 3300042643 Bacteria 6271
81 Ga0466704_484062 3300042643 Bacteria 4228
82 Ga0466704_571957 3300042643 Bacteria 15856
83 Ga0466729_091910 3300042621 Bacteria 1819
84 Ga0466707_157037 3300042601 Bacteria 1044
85 Ga0466722_153161 3300042609 Bacteria 4267
86 Ga0255572_1006710 3300026175 Bacteria 3609
87 Ga0466696_117413 3300042596 Bacteria 28050
88 Ga0123356_10292056 3300010049 Bacteria 1731
89 IMNBL1DRAFT_c0002846 3300000062 Bacteria 11633
90 AustNasuHG_c1004718 3300000089 Unclassified 4884
91 JGI24702J35022_10010328 3300002462 Bacteria 5218
92 Ga0068302_10013086 3300005071 Bacteria 7814
93 Ga0068305_10216088 3300005083 Bacteria 2120
94 Ga0072940_1195002 3300005200 Unclassified 1516
95 Ga0530661_000022 3300056564 Bacteria 194089
96 Ga0562379_0049 3300056790 Bacteria 522222
97 Ga0562377_0019 3300056842 Bacteria 1067000
98 Ga0562375_1666 3300056856 Bacteria 28581
99 Ga0466729_207820 3300042621 Bacteria 11852
100 Ga0466709_209507 3300042648 Bacteria 6668
101 Ga0466715_055478 3300042616 Bacteria 27402
102 Ga0466715_247075 3300042616 Bacteria 1692
103 Ga0466728_046430 3300042620 Bacteria 43059
104 Ga0466713_117047 3300042602 Bacteria 144191
105 Ga0466719_285681 3300042606 Unclassified 2411
106 Ga0160455_100724 3300012837 Bacteria 13510
107 Ga0247289_1385 3300035363 Bacteria 2276
108 Ga0466693_276524 3300042592 Bacteria 1412
109 Ga0123353_10102044 3300010167 Bacteria 4624
110 JGI24705J35276_12235773 3300002504 Bacteria 6966
111 JGI24696J40584_12940291 3300002834 Bacteria 1674
112 Ga0063521_1000130 3300003973 Bacteria 58438
113 Ga0562379_0017 3300056790 Bacteria 1147482
114 Ga0562379_0748 3300056790 Bacteria 54170
115 Ga0562374_0016 3300057007 Bacteria 1205025
116 Ga0466734_014796 3300042623 Bacteria 12704
117 Ga0466708_181389 3300042652 Bacteria 30464
118 Ga0466715_087514 3300042616 Bacteria 35967
119 Ga0466706_021240 3300042599 Bacteria 6844
120 Ga0466707_162390 3300042601 Bacteria 63505
121 Ga0160447_112318 3300012849 Bacteria 1749
122 Ga0255575_1000917 3300026559 Bacteria 49164
123 Ga0466690_169890 3300042590 Bacteria 4819
124 Ga0466696_002326 3300042596 Bacteria 16543
125 Ga0123355_10000636 3300009826 Bacteria 47516
126 Ga0123355_10764848 3300009826 Unclassified 1088
127 Ga0123353_10638856 3300010167 Bacteria 1510
128 Ga0123353_11135869 3300010167 Bacteria 1033
129 Ga0123354_10287963 3300010882 Bacteria 1580
130 Ga0160466_100221 3300012809 Bacteria 40944
131 JGI24702J35022_10071885 3300002462 Bacteria 1864
132 JGI24702J35022_10121017 3300002462 Unclassified 1446
133 JGI24703J35330_11748295 3300002501 Bacteria 13391
134 JGI24705J35276_12068452 3300002504 Unclassified 949
135 JGI24705J35276_12210132 3300002504 Bacteria 1816
136 Ga0104041_1117967 3300007106 Bacteria 1167
137 Ga0105005_1021358 3300007505 Bacteria 7935
138 Ga0111035_102935 3300007901 Bacteria 18284
139 Ga0111037_112856 3300008519 Bacteria 3289
140 Ga0562379_0325 3300056790 Unclassified 116843
141 Ga0562374_0842 3300057007 Bacteria 43365
142 Ga0466734_045335 3300042623 Bacteria 3191
143 Ga0466725_105823 3300042654 Bacteria 1404
144 Ga0466715_541400 3300042616 Unclassified 1632
145 Ga0466700_014411 3300042600 Bacteria 3010
146 Ga0415639_074308 3300038395 Bacteria 2471
147 Ga0123356_10315932 3300010049 Bacteria 1673
148 Ga0123353_10001343 3300010167 Bacteria 30161
149 Ga0104050_1208021 3300007153 Bacteria 1092

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012849 Ga0160447_112318 Ga0160447_1123182 212
2 iso_pr_bacteria 2820205024 2820206522 213
3 3300042550 Ga0466656_252214 Ga0466656_252214_20_667 215
4 3300010167 Ga0123353_10102044 Ga0123353_101020447 219
5 3300042593 Ga0466691_004164 Ga0466691_004164_21077_21766 220
6 3300042620 Ga0466728_046430 Ga0466728_046430_406_1095 220
7 3300010049 Ga0123356_10000572 Ga0123356_1000057215 222
8 3300042601 Ga0466707_262781 Ga0466707_262781_2055_2732 225
9 3300042605 Ga0466716_300015 Ga0466716_300015_1649_2326 225
10 3300009826 Ga0123355_10000636 Ga0123355_1000063641 226
11 3300042636 Ga0466703_106684 Ga0466703_106684_6165_6869 226
12 iso_pr_bacteria 2820848511 2820849153 226
13 3300002504 JGI24705J35276_12235773 JGI24705J35276_122357738 227
14 3300010167 Ga0123353_10045818 Ga0123353_100458186 227
15 3300042618 Ga0466723_145021 Ga0466723_145021_8938_9621 227
16 3300042620 Ga0466728_409986 Ga0466728_409986_2068_2751 227
17 iso_pr_bacteria 2630968413 2631702611 227
18 iso_pr_bacteria 2851412233 2851412409 227
19 iso_pr_bacteria 2852431164 2852434077 227
20 iso_pr_bacteria 2956926959 2956927064 227
21 iso_pr_bacteria 2956928875 2956929402 227
22 iso_pr_bacteria 2956930723 2956931390 227
23 3300010167 Ga0123353_10638856 Ga0123353_106388561 228
24 3300026175 Ga0255572_1006710 Ga0255572_10067103 228
25 3300026558 Ga0255576_1000225 Ga0255576_100022528 228
26 3300026559 Ga0255575_1000917 Ga0255575_100091738 228
27 3300042596 Ga0466696_117413 Ga0466696_117413_26785_27471 228
28 3300042606 Ga0466719_523800 Ga0466719_523800_6251_6937 228
29 3300042616 Ga0466715_042181 Ga0466715_042181_24585_25271 228
30 3300042643 Ga0466704_327441 Ga0466704_327441_2855_3541 228
31 iso_pr_bacteria 2820477775 2820478899 228
32 iso_pr_bacteria 2820558799 2820559241 228
33 iso_pr_bacteria 2914375287 2914375974 228
34 3300035363 Ga0247289_1385 Ga0247289_1385_288_977 229
35 3300038395 Ga0415639_053171 Ga0415639_053171_4430_5119 229
36 3300042590 Ga0466690_169890 Ga0466690_169890_1760_2449 229
37 3300042599 Ga0466706_137549 Ga0466706_137549_1089_1778 229
38 3300042601 Ga0466707_162390 Ga0466707_162390_33677_34366 229
39 3300042601 Ga0466707_278592 Ga0466707_278592_128342_129031 229
40 3300042609 Ga0466722_236472 Ga0466722_236472_636_1325 229
41 3300042616 Ga0466715_055478 Ga0466715_055478_15184_15873 229
42 3300042616 Ga0466715_282602 Ga0466715_282602_38410_39099 229
43 3300042649 Ga0466724_01144 Ga0466724_01144_13781_14470 229
44 3300056564 Ga0530661_000022 Ga0530661_000022_177446_178135 229
45 3300056564 Ga0530661_000024 Ga0530661_000024_25492_26181 229
46 3300056790 Ga0562379_0017 Ga0562379_0017_691875_692564 229
47 3300056790 Ga0562379_0049 Ga0562379_0049_228028_228717 229
48 3300056790 Ga0562379_0681 Ga0562379_0681_32241_32930 229
49 3300056790 Ga0562379_0748 Ga0562379_0748_48906_49595 229
50 3300056814 Ga0562378_0771 Ga0562378_0771_26749_27438 229
51 3300056842 Ga0562377_0019 Ga0562377_0019_232950_233639 229
52 3300056856 Ga0562375_0025 Ga0562375_0025_110182_110871 229
53 3300056856 Ga0562375_1666 Ga0562375_1666_14468_15157 229
54 3300056857 Ga0562376_1810 Ga0562376_1810_8934_9623 229
55 3300057007 Ga0562374_0016 Ga0562374_0016_898577_899266 229
56 3300057007 Ga0562374_0842 Ga0562374_0842_19741_20430 229
57 iso_pr_bacteria 2585428141 2588053439 229
58 iso_pr_bacteria 2595698190 2596206564 229
59 iso_pr_bacteria 2595698193 2596211976 229
60 iso_pr_bacteria 2595698194 2596212288 229
61 iso_pr_bacteria 2595698195 2596215652 229
62 iso_pr_bacteria 2595698196 2596217479 229
63 iso_pr_bacteria 2595698197 2596219315 229
64 iso_pr_bacteria 2595698198 2596221147 229
65 iso_pr_bacteria 2595698199 2596222952 229
66 iso_pr_bacteria 2622736579 2623393541 229
67 iso_pr_bacteria 2627853628 2628281376 229
68 iso_pr_bacteria 2740892556 2743947874 229
69 iso_pr_bacteria 2775507073 2777017057 229
70 iso_pr_bacteria 2825804107 2825804692 229
71 iso_pr_bacteria 2873581347 2873581967 229
72 iso_pr_bacteria 2873584433 2873585016 229
73 iso_pr_bacteria 2881375749 2881376910 229
74 iso_pr_bacteria 2900804455 2900804474 229
75 iso_pr_bacteria 2940218408 2940219073 229
76 iso_pr_bacteria 2940261461 2940261982 229
77 iso_pr_bacteria 647533136 647747136 229
78 iso_pr_bacteria 650716050 650845970 229
79 iso_pr_bacteria 8007211731 8007213001 229
80 iso_pr_bacteria 8007215774 8007218914 229
81 iso_pr_bacteria 8007220153 8007223620 229
82 iso_pr_bacteria 8007223943 8007224055 229
83 iso_pr_bacteria 8007237282 8007237418 229
84 iso_pr_bacteria 8012939035 8012940450 229
85 iso_pr_bacteria 8018750880 8018753607 229
86 iso_pr_bacteria 8018754795 8018755838 229
87 iso_pr_bacteria 8018794549 8018796885 229
88 iso_pr_bacteria 8018798118 8018799475 229
89 iso_pr_bacteria 8018802046 8018804274 229
90 iso_pr_bacteria 8038268975 8038271775 229
91 iso_pr_bacteria 8077780672 8077782879 229
92 iso_pr_bacteria 8082023105 8082023239 229
93 iso_pr_bacteria 8108568626 8108569329 229
94 iso_pr_bacteria 8108576847 8108579718 229
95 iso_pr_bacteria 8114537524 8114538852 229
96 iso_pr_bacteria 8114541043 8114544452 229
97 iso_pr_bacteria 8114544644 8114548481 229
98 iso_pr_bacteria 8114549044 8114551915 229
99 iso_pr_bacteria 8114555646 8114556349 229
100 3300002932 CVPL010L_1000369 CVPL010L_10003699 230
101 3300005083 Ga0068305_10216088 Ga0068305_102160882 230
102 3300005200 Ga0072940_1195002 Ga0072940_11950021 230
103 3300007106 Ga0104041_1117967 Ga0104041_11179672 230
104 3300007150 Ga0104019_1004266 Ga0104019_10042662 230
105 3300007153 Ga0104050_1208021 Ga0104050_12080212 230
106 3300038395 Ga0415639_074308 Ga0415639_074308_788_1480 230
107 3300042598 Ga0466701_101169 Ga0466701_101169_42682_43374 230
108 3300042599 Ga0466706_096843 Ga0466706_096843_1203_1895 230
109 3300042606 Ga0466719_285681 Ga0466719_285681_1430_2122 230
110 3300042606 Ga0466719_471935 Ga0466719_471935_34600_35292 230
111 3300042616 Ga0466715_586554 Ga0466715_586554_1376_2068 230
112 3300042619 Ga0466726_064906 Ga0466726_064906_33967_34659 230
113 3300042619 Ga0466726_065279 Ga0466726_065279_3769_4461 230
114 3300042655 Ga0466727_142534 Ga0466727_142534_54886_55578 230
115 iso_pr_bacteria 2523231078 2523496935 230
116 iso_pr_bacteria 2537562000 2539439120 230
117 iso_pr_bacteria 2551306396 2552923432 230
118 iso_pr_bacteria 2563367190 2565785833 230
119 iso_pr_bacteria 2576861701 2579272606 230
120 iso_pr_bacteria 2822232166 2822237517 230
121 iso_pr_bacteria 2822450720 2822454936 230
122 iso_pr_bacteria 2827179085 2827180992 230
123 iso_pr_bacteria 2834951433 2834951536 230
124 iso_pr_bacteria 2836667214 2836667269 230
125 iso_pr_bacteria 2849099867 2849100114 230
126 iso_pr_bacteria 2849104611 2849109005 230
127 iso_pr_bacteria 2850744690 2850748626 230
128 iso_pr_bacteria 2864782175 2864787782 230
129 iso_pr_bacteria 2890957088 2890959892 230
130 iso_pr_bacteria 2896402965 2896403611 230
131 iso_pr_bacteria 2916873227 2916877999 230
132 iso_pr_bacteria 2940221333 2940227834 230
133 iso_pr_bacteria 2940380068 2940385591 230
134 iso_pr_bacteria 2940386776 2940392349 230
135 iso_pr_bacteria 2940393498 2940398999 230
136 iso_pr_bacteria 2940400224 2940405747 230
137 iso_pr_bacteria 2940406939 2940412264 230
138 iso_pr_bacteria 2940413413 2940419346 230
139 iso_pr_bacteria 2940419646 2940425684 230
140 iso_pr_bacteria 2940425923 2940431914 230
141 iso_pr_bacteria 2969145278 2969148823 230
142 iso_pr_bacteria 2971438493 2971439377 230
143 iso_pr_bacteria 2978778678 2978782149 230
144 iso_pr_bacteria 2983866074 2983871076 230
145 iso_pr_bacteria 643886090 644659312 230
146 iso_pr_bacteria 643886091 644646282 230
147 iso_pr_bacteria 8022725327 8022727583 230
148 iso_pr_bacteria 8022781829 8022785450 230
149 iso_pr_bacteria 8061039349 8061044250 230
150 iso_pr_bacteria 8061045771 8061048982 230
151 iso_pr_bacteria 8061100935 8061103444 230
152 3300003973 Ga0063521_1000130 Ga0063521_100013021 231
153 3300005071 Ga0068302_10015215 Ga0068302_1001521515 231
154 3300007505 Ga0105005_1021358 Ga0105005_10213589 231
155 3300010049 Ga0123356_10292056 Ga0123356_102920563 231
156 3300012805 Ga0160464_100835 Ga0160464_10083510 231
157 3300012809 Ga0160466_100221 Ga0160466_10022130 231
158 3300012837 Ga0160455_100724 Ga0160455_1007245 231
159 3300038395 Ga0415639_038553 Ga0415639_038553_1594_2289 231
160 3300042596 Ga0466696_002326 Ga0466696_002326_10149_10844 231
161 3300042599 Ga0466706_021240 Ga0466706_021240_5847_6542 231
162 3300042600 Ga0466700_014411 Ga0466700_014411_233_928 231
163 3300042601 Ga0466707_157037 Ga0466707_157037_145_840 231
164 3300042623 Ga0466734_045335 Ga0466734_045335_269_964 231
165 3300042643 Ga0466704_571957 Ga0466704_571957_13405_14100 231
166 3300042654 Ga0466725_105823 Ga0466725_105823_395_1090 231
167 3300056790 Ga0562379_0325 Ga0562379_0325_94950_95645 231
168 3300056790 Ga0562379_1612 Ga0562379_1612_3125_3820 231
169 3300056790 Ga0562379_4537 Ga0562379_4537_788_1483 231
170 3300056842 Ga0562377_0208 Ga0562377_0208_113991_114686 231
171 3300056857 Ga0562376_1714 Ga0562376_1714_8939_9634 231
172 iso_pr_bacteria 2731957677 2732686812 231
173 iso_pr_bacteria 2740892557 2743952625 231
174 iso_pr_bacteria 2820301196 2820301908 231
175 iso_pr_bacteria 2820327087 2820327684 231
176 iso_pr_bacteria 2820871393 2820872539 231
177 iso_pr_bacteria 2820880921 2820880968 231
178 iso_pr_bacteria 2820934415 2820935589 231
179 iso_pr_bacteria 2864816158 2864821949 231
180 iso_pr_bacteria 2864985977 2864987878 231
181 iso_pr_bacteria 2917496769 2917497805 231
182 iso_pr_bacteria 8012112996 8012114670 231
183 iso_pr_bacteria 8112490586 8112492661 231
184 2209111004 2212886494 2212667162 232
185 2225789004 2227563513 2228103167 232
186 3300000089 AustNasuHG_c1004718 AustNasuHG_10047185 232
187 3300002501 JGI24703J35330_11459859 JGI24703J35330_114598591 232
188 3300002501 JGI24703J35330_11748295 JGI24703J35330_117482956 232
189 3300002507 JGI24697J35500_11213521 JGI24697J35500_112135212 232
190 3300005200 Ga0072940_1147877 Ga0072940_11478773 232
191 3300009826 Ga0123355_10068135 Ga0123355_100681355 232
192 3300009826 Ga0123355_10217607 Ga0123355_102176072 232
193 3300010167 Ga0123353_10978176 Ga0123353_109781761 232
194 3300042611 Ga0466697_064414 Ga0466697_064414_765_1463 232
195 3300042649 Ga0466724_48958 Ga0466724_48958_453_1151 232
196 iso_pr_bacteria 2524614537 2524835981 232
197 iso_pr_bacteria 2574180310 2576357544 232
198 iso_pr_bacteria 2751185832 2753512172 232
199 iso_pr_bacteria 2767802234 2769328199 232
200 iso_pr_bacteria 2791355481 2794422382 232
201 iso_pr_bacteria 2820371985 2820373771 232
202 iso_pr_bacteria 2843246524 2843246747 232
203 iso_pr_bacteria 2852123468 2852127099 232
204 iso_pr_bacteria 2855361764 2855365620 232
205 iso_pr_bacteria 2864801025 2864804889 232
206 iso_pr_bacteria 2864895409 2864899271 232
207 iso_pr_bacteria 2864909992 2864913917 232
208 iso_pr_bacteria 8043041867 8043045565 232
209 2225789004 2227480184 2227939006 233
210 3300000062 IMNBL1DRAFT_c0002846 IMNBL1DRAFT_00028465 233
211 3300009826 Ga0123355_10714063 Ga0123355_107140632 233
212 3300038395 Ga0415639_119748 Ga0415639_119748_384_1085 233
213 3300042592 Ga0466693_276524 Ga0466693_276524_82_783 233
214 3300042594 Ga0466694_036923 Ga0466694_036923_393_1094 233
215 3300042600 Ga0466700_383333 Ga0466700_383333_7785_8486 233
216 3300042601 Ga0466707_089502 Ga0466707_089502_8622_9323 233
217 3300042602 Ga0466713_117047 Ga0466713_117047_140878_141579 233
218 3300042613 Ga0466710_319995 Ga0466710_319995_13_714 233
219 3300042623 Ga0466734_014796 Ga0466734_014796_2049_2750 233
220 3300042623 Ga0466734_075033 Ga0466734_075033_1964_2665 233
221 iso_pr_bacteria 2636416028 2638996422 233
222 iso_pr_bacteria 2820748953 2820749631 233
223 iso_pr_bacteria 2864981449 2864984058 233
224 iso_pr_bacteria 2916858470 2916863211 233
225 iso_pr_bacteria 8064008355 8064008484 233
226 3300002462 JGI24702J35022_10010328 JGI24702J35022_100103284 234
227 3300002462 JGI24702J35022_10019717 JGI24702J35022_100197173 234
228 3300002462 JGI24702J35022_10121017 JGI24702J35022_101210172 234
229 3300002504 JGI24705J35276_12068452 JGI24705J35276_120684521 234
230 3300002504 JGI24705J35276_12210132 JGI24705J35276_122101322 234
231 3300002834 JGI24696J40584_12940291 JGI24696J40584_129402912 234
232 3300002834 JGI24696J40584_12957527 JGI24696J40584_129575274 234
233 3300009826 Ga0123355_10764848 Ga0123355_107648482 234
234 3300010049 Ga0123356_10315932 Ga0123356_103159323 234
235 3300010049 Ga0123356_10738237 Ga0123356_107382372 234
236 3300010167 Ga0123353_10001343 Ga0123353_100013436 234
237 3300010167 Ga0123353_10002158 Ga0123353_100021586 234
238 3300010167 Ga0123353_11135869 Ga0123353_111358692 234
239 3300010882 Ga0123354_10287963 Ga0123354_102879632 234
240 3300024493 Ga0264413_162424 Ga0264413_1624241 234
241 3300042595 Ga0466695_319579 Ga0466695_319579_139_843 234
242 3300042621 Ga0466729_091910 Ga0466729_091910_466_1170 234
243 3300042659 Ga0466733_031080 Ga0466733_031080_5941_6645 234
244 3300005201 Ga0072941_1418630 Ga0072941_14186302 235
245 3300010049 Ga0123356_11220452 Ga0123356_112204521 235
246 3300010167 Ga0123353_10936190 Ga0123353_109361902 235
247 3300042606 Ga0466719_084719 Ga0466719_084719_9751_10458 235
248 3300042606 Ga0466719_522406 Ga0466719_522406_643_1350 235
249 3300042609 Ga0466722_153161 Ga0466722_153161_403_1110 235
250 3300042616 Ga0466715_087514 Ga0466715_087514_15269_15976 235
251 3300042616 Ga0466715_541400 Ga0466715_541400_676_1383 235
252 3300042652 Ga0466708_181389 Ga0466708_181389_4043_4750 235
253 iso_pr_bacteria 2503538010 2503576181 235
254 3300009826 Ga0123355_10033229 Ga0123355_100332296 236
255 3300002462 JGI24702J35022_10071885 JGI24702J35022_100718853 239
256 3300042616 Ga0466715_247075 Ga0466715_247075_883_1602 239
257 3300042596 Ga0466696_257695 Ga0466696_257695_5385_6107 240
258 3300042619 Ga0466726_186614 Ga0466726_186614_9880_10602 240
259 3300042643 Ga0466704_484062 Ga0466704_484062_3429_4151 240
260 3300005071 Ga0068302_10013086 Ga0068302_100130866 241
261 3300042620 Ga0466728_333581 Ga0466728_333581_438_1163 241
262 3300042604 Ga0466717_041744 Ga0466717_041744_158_886 242
263 3300042643 Ga0466704_418643 Ga0466704_418643_871_1599 242
264 iso_pr_bacteria 2820822094 2820823247 242
265 3300042612 Ga0466705_110843 Ga0466705_110843_1388_2119 243
266 3300005071 Ga0068302_10156818 Ga0068302_101568183 245
267 3300042623 Ga0466734_109007 Ga0466734_109007_494_1231 245
268 iso_pr_bacteria 643886085 644677640 245
269 iso_pr_bacteria 643886087 644665430 245
270 3300008519 Ga0111037_112856 Ga0111037_1128562 247
271 3300042621 Ga0466729_207820 Ga0466729_207820_3517_4263 248
272 3300007901 Ga0111035_102935 Ga0111035_1029352 254
273 3300042648 Ga0466709_209507 Ga0466709_209507_2341_3123 260
274 3300042625 Ga0466730_044605 Ga0466730_044605_827_1624 265

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 25 200 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.