Protein Family IF04011

Metagenome Isolate
259 Members
207 Samples
116 Scaffolds
399.31 Avg Length

🧬 Representative Sequence

ID
3300012849|Ga0160447_104398|Ga0160447_1043983
Length
452 aa
Sequence
MVEKNRKNLEKTACDLSPRPAMLSILTPRLRTALVHSAGAMPPIHSPFRAAAKMSLFSAVEMAPRDPILGLNEAFNADTRTTKVNLGVGVYSNEEGKIPLLRAVAEAEEIRVAQHVPRGYLPIDGIAAYDKAVQTLLFGAESPLLASGRVMTVQAVGGTGALKIGADFLKQLSPNAVVAISDPSWENHRALFETAGFPVQNYRYYDAGTHDVNRAGMLEDLQNLPSGSIVVLHACCHNPTGVDLTLEDWKKVLEVLKAKGHVPFLDMAYQGFGDGIDEDAAAVRLFADSGLTFFASSSFSKSFSLYGERVGALSIVTDSKEETARVLSQVKRVIRTNYSNPPTHGATIVAAVLNSPELRQKWEDELAEMRLRIRGMREEMTNRLANNAAGQDFSFVARQRGMFSYSGLTTEQVHRLRNEFGIYALDTGRICVAALNKRNIEAVTQAILAVI*

📊 Sample Types

Isolate 55.2%
Metagenome 44.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 40.2%
Unclassified 11.6%
Termitidae 9.0%
Elmidae 8.5%
Formicidae 6.0%
Culicidae 6.0%
Curculionidae 5.5%
Kalotermitidae 3.0%
Armadillidiidae 2.0%
Hydrophilidae 1.0%
Berytidae 1.0%
Largidae 1.0%
Apidae 1.0%
Alydidae 1.0%
Siricidae 0.5%
Rhinotermitidae 0.5%
Trigoniulidae 0.5%
Termopsidae 0.5%
Gryllidae 0.5%
Drosophilidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
2 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
3 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
4 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
5 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
8 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
9 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
10 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
11 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
15 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
20 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
21 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
22 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
23 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
24 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
25 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
26 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
27 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
28 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
29 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
30 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
31 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
32 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
33 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
36 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
37 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
38 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
39 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
40 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
41 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
42 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
43 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
44 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
45 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
46 8052469819 Pseudomonas putida DZ-F23 Isolate
47 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
48 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
49 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
50 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
51 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
52 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
53 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
54 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
55 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
56 2868169047 Comamonas aquatica S00077 Isolate Elmidae
57 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
58 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
59 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
60 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
61 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
62 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
63 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
64 8023757577 Caballeronia peredens LP006 Isolate Coreidae
65 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
66 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
67 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
68 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
69 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
70 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
71 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
72 8100461708 Delftia sp. S65 Isolate Curculionidae
73 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
74 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
75 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
76 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
77 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
78 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
79 2864755708 Massilia timonae S00006 Isolate Elmidae
80 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
81 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
82 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
83 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
84 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
85 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
86 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
87 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
88 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
89 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
90 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
91 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
92 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
93 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
94 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
95 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
96 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
97 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
98 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
99 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
100 8100455565 Delftia sp. S67 Isolate Curculionidae
101 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
102 8102102351 Caballeronia sp. INML1 Isolate Coreidae
103 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
104 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
105 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
106 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
107 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
108 2864937364 Acidovorax soli S00198 Isolate Elmidae
109 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
110 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
111 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
112 2603880173 Pseudomonas SP. Isolate Unclassified
113 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
114 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
115 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
116 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
117 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
118 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
119 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
120 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
121 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
122 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
123 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
124 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
125 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
126 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
127 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
128 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
129 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
130 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
131 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
132 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
133 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
134 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
135 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
136 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
137 8102117041 Caballeronia sp. INML3 Isolate Coreidae
138 8102131453 Caballeronia sp. INML5 Isolate Coreidae
139 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
140 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
141 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
142 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
143 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
144 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
145 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
146 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
147 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
148 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
149 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
150 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
151 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
152 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
153 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
154 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
155 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
156 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
157 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
158 637000219 Pseudomonas entomophila L48 Isolate Unclassified
159 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
160 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
161 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
162 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
163 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
164 8102124461 Caballeronia sp. INML3B Isolate Coreidae
165 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
166 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
167 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
168 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
169 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
170 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
171 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
172 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
173 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
174 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
175 8069748016 Caballeronia sp. LP003 Isolate Coreidae
176 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
177 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
178 8102109360 Caballeronia sp. INML2 Isolate Coreidae
179 8102145433 Caballeronia sp. LP006 Isolate Coreidae
180 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
181 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
182 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
183 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
184 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
185 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
186 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
187 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
188 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
189 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
190 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
191 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
192 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
193 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
194 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
195 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
196 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
197 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
198 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
199 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
200 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
201 8035422605 Pseudomonas monteilii CY06 Isolate
202 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
203 8100449422 Delftia sp. S66 Isolate Curculionidae
204 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
205 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
206 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
207 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10007002 3300010167 Bacteria 15157
2 Ga0160442_100103 3300012806 Bacteria 97974
3 Ga0466701_020495 3300042598 Bacteria 50255
4 Ga0466701_052746 3300042598 Bacteria 75905
5 DPO_contig03378 2032320009 Bacteria 62025
6 SPBB_contig11619 2044078006 Bacteria 14847
7 Ga0160433_100062 3300012846 Bacteria 118663
8 Ga0160447_104398 3300012849 Bacteria 4178
9 Ga0466696_012277 3300042596 Bacteria 3141
10 Ga0466710_034401 3300042613 Bacteria 4317
11 Ga0466730_088042 3300042625 Bacteria 113057
12 Ga0466725_257671 3300042654 Unclassified 16147
13 Ga0123354_10010422 3300010882 Bacteria 14319
14 Ga0466701_045301 3300042598 Bacteria 173556
15 Ga0466701_050835 3300042598 Bacteria 85783
16 SPBB_contig04137 2044078006 Bacteria 31981
17 Meta3P_1003579 3300002464 Bacteria 3685
18 Ga0103266_1000381 3300007067 Bacteria 10121
19 Ga0102734_1000771 3300007129 Bacteria 8606
20 Ga0160460_102140 3300012845 Bacteria 5020
21 Ga0466696_115564 3300042596 Bacteria 5401
22 Ga0466734_080504 3300042623 Bacteria 5110
23 Ga0466703_197512 3300042636 Bacteria 5285
24 Ga0466724_07603 3300042649 Bacteria 364013
25 Ga0466724_08038 3300042649 Bacteria 50733
26 Ga0466724_52528 3300042649 Bacteria 12254
27 Ga0160471_101249 3300012812 Unclassified 5296
28 Ga0466701_089458 3300042598 Bacteria 1743
29 DPO_contig08870 2032320009 Bacteria 5539
30 JGI24705J35276_12234412 3300002504 Unclassified 5494
31 Ga0102735_1000086 3300007080 Bacteria 25408
32 Ga0123357_10000008 3300009784 Bacteria 232327
33 Ga0160467_100193 3300012829 Bacteria 80995
34 Ga0160472_101149 3300012839 Bacteria 8775
35 Ga0466695_113437 3300042595 Bacteria 2635
36 Ga0466701_002451 3300042598 Bacteria 107637
37 Ga0466710_075927 3300042613 Bacteria 7471
38 Ga0466712_156454 3300042614 Bacteria 2196
39 Ga0466726_411884 3300042619 Bacteria 3675
40 Ga0466724_25351 3300042649 Bacteria 84930
41 Ga0466708_087100 3300042652 Bacteria 8823
42 Ga0466725_133362 3300042654 Bacteria 1949
43 Ga0160454_100472 3300012798 Unclassified 15271
44 Ga0103263_100382 3300007042 Unclassified 6125
45 Ga0103264_1000231 3300007188 Bacteria 33914
46 Ga0103267_1000054 3300007190 Bacteria 63026
47 Ga0103268_1000041 3300007192 Bacteria 43742
48 Ga0160453_101378 3300012814 Unclassified 8579
49 Ga0160467_101235 3300012829 Unclassified 11472
50 Ga0160447_100704 3300012849 Bacteria 14579
51 Ga0160447_105276 3300012849 Unclassified 3640
52 Ga0466657_398284 3300042582 Bacteria 10195
53 Ga0466710_362546 3300042613 Bacteria 89580
54 Ga0466711_432945 3300042615 Bacteria 5340
55 Ga0466730_029519 3300042625 Unclassified 4956
56 Ga0466730_070891 3300042625 Bacteria 5122
57 Ga0466725_086557 3300042654 Bacteria 2414
58 Ga0466725_343028 3300042654 Bacteria 1570
59 Ga0466725_394896 3300042654 Bacteria 1470
60 Ga0160470_100065 3300012813 Bacteria 151122
61 FGTW_contig31269 2065487013 Unclassified 4384
62 JGI24702J35022_10000771 3300002462 Unclassified 19868
63 Ga0103265_1000553 3300007068 Bacteria 6362
64 Ga0103260_1005467 3300007139 Unclassified 1866
65 Ga0103264_1001896 3300007188 Bacteria 10880
66 Ga0103267_1000052 3300007190 Bacteria 68999
67 Ga0103267_1000625 3300007190 Bacteria 10002
68 Ga0160431_100062 3300012828 Bacteria 89809
69 Ga0160431_101034 3300012828 Unclassified 8477
70 Ga0160459_100057 3300012831 Bacteria 169256
71 Ga0160444_100184 3300012841 Bacteria 57666
72 Ga0466711_137279 3300042615 Bacteria 18983
73 Ga0466729_130197 3300042621 Bacteria 87574
74 Ga0466734_133119 3300042623 Bacteria 13067
75 Ga0466725_033474 3300042654 Bacteria 67169
76 Ga0123354_10113368 3300010882 Bacteria 3562
77 HBC_ctgsDRAFT_1000009 3300000333 Bacteria 57482
78 CVPL005W_1000116 3300002934 Bacteria 36019
79 Ga0103266_1000078 3300007067 Bacteria 50240
80 Ga0102735_1000050 3300007080 Bacteria 31845
81 Ga0103264_1000046 3300007188 Bacteria 103239
82 Ga0103268_1000574 3300007192 Unclassified 10877
83 Ga0105005_1017883 3300007505 Unclassified 4676
84 Ga0160460_103930 3300012845 Bacteria 2435
85 Ga0160434_103287 3300012850 Unclassified 2741
86 Ga0160435_1000255 3300012857 Bacteria 24562
87 Ga0466657_204557 3300042582 Bacteria 1766
88 Ga0466701_004813 3300042598 Unclassified 2335
89 Ga0466705_460685 3300042612 Bacteria 61159
90 Ga0466718_063200 3300042617 Bacteria 5298
91 Ga0466730_023485 3300042625 Bacteria 1503
92 Ga0466702_257329 3300042635 Bacteria 11837
93 Ga0466717_011554 3300042604 Bacteria 5790
94 SWWA_contig31653__length_27474___numreads_1390 2100351016 Bacteria 27474
95 CVPL010W_10016161 3300002931 Bacteria 5092
96 Ga0103266_1000058 3300007067 Bacteria 46132
97 Ga0103265_1000321 3300007068 Bacteria 14929
98 Ga0102738_1000749 3300007141 Unclassified 5203
99 Ga0160470_104168 3300012813 Bacteria 2118
100 Ga0160446_100070 3300012835 Bacteria 101842
101 Ga0160436_1005600 3300012861 Unclassified 2946
102 Ga0466657_045754 3300042582 Unclassified 5748
103 Ga0466693_313044 3300042592 Bacteria 1601
104 Ga0466734_066457 3300042623 Bacteria 23783
105 Ga0466730_014802 3300042625 Bacteria 4701
106 Ga0123354_10018125 3300010882 Bacteria 11037
107 SWWA_contig23055__length_2056___numreads_41 2100351016 Bacteria 2056
108 Ga0103268_1000020 3300007192 Bacteria 52364
109 Ga0160453_103042 3300012814 Bacteria 3677
110 Ga0160456_100293 3300012820 Bacteria 20740
111 Ga0160452_100019 3300012834 Bacteria 279189
112 Ga0466657_340854 3300042582 Bacteria 25164
113 Ga0466728_090779 3300042620 Bacteria 3281
114 Ga0466730_030029 3300042625 Bacteria 423027
115 Ga0466724_56026 3300042649 Unclassified 13507
116 Ga0466725_090681 3300042654 Unclassified 6915

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_034401 Ga0466710_034401_1274_2488 387
2 2044078006 SPBB_contig11619 SPBB_608340 390
3 3300007190 Ga0103267_1000625 Ga0103267_10006252 390
4 3300007067 Ga0103266_1000058 Ga0103266_100005822 395
5 3300007068 Ga0103265_1000553 Ga0103265_10005537 395
6 iso_pr_bacteria 2990166910 2990171691 395
7 3300007188 Ga0103264_1000046 Ga0103264_100004656 396
8 iso_pr_bacteria 2870361953 2870363051 396
9 iso_pr_bacteria 3000478755 3000480614 396
10 3300000333 HBC_ctgsDRAFT_1000009 HBC_ctgsDRAFT_100000938 397
11 3300012814 Ga0160453_103042 Ga0160453_1030422 397
12 3300012828 Ga0160431_100062 Ga0160431_10006238 397
13 2032320009 DPO_contig03378 DPOB_405860 398
14 2032320009 DPO_contig08870 DPOB_555010 398
15 2044078006 SPBB_contig04137 SPBB_939170 398
16 2065487013 FGTW_contig31269 FGTW_03180890 398
17 2100351016 SWWA_contig23055__length_2056___numreads_41 SWWA_01551550 398
18 2100351016 SWWA_contig31653__length_27474___numreads_1390 SWWA_01953150 398
19 3300042582 Ga0466657_204557 Ga0466657_204557_406_1602 398
20 3300042592 Ga0466693_313044 Ga0466693_313044_345_1541 398
21 3300042598 Ga0466701_002451 Ga0466701_002451_61378_62574 398
22 3300042598 Ga0466701_004813 Ga0466701_004813_853_2049 398
23 3300042598 Ga0466701_020495 Ga0466701_020495_46546_47742 398
24 3300042598 Ga0466701_045301 Ga0466701_045301_154414_155610 398
25 3300042598 Ga0466701_052746 Ga0466701_052746_39268_40464 398
26 3300042623 Ga0466734_066457 Ga0466734_066457_19891_21087 398
27 3300042625 Ga0466730_014802 Ga0466730_014802_2657_3853 398
28 3300042625 Ga0466730_023485 Ga0466730_023485_144_1340 398
29 3300042625 Ga0466730_029519 Ga0466730_029519_676_1872 398
30 3300042625 Ga0466730_030029 Ga0466730_030029_76343_77539 398
31 3300042625 Ga0466730_088042 Ga0466730_088042_16126_17322 398
32 3300042649 Ga0466724_07603 Ga0466724_07603_291827_293023 398
33 3300042649 Ga0466724_08038 Ga0466724_08038_34359_35555 398
34 3300042649 Ga0466724_25351 Ga0466724_25351_5390_6586 398
35 3300042649 Ga0466724_52528 Ga0466724_52528_3957_5153 398
36 3300042649 Ga0466724_56026 Ga0466724_56026_5347_6543 398
37 3300042654 Ga0466725_086557 Ga0466725_086557_141_1337 398
38 3300042654 Ga0466725_090681 Ga0466725_090681_141_1337 398
39 3300042654 Ga0466725_133362 Ga0466725_133362_311_1507 398
40 iso_pr_bacteria 2518285616 2518643588 398
41 iso_pr_bacteria 2519899622 2520392071 398
42 iso_pr_bacteria 2603880173 2606035736 398
43 iso_pr_bacteria 2687453754 2690041041 398
44 iso_pr_bacteria 2687453755 2690042747 398
45 iso_pr_bacteria 2687453756 2690046937 398
46 iso_pr_bacteria 2864739902 2864744597 398
47 iso_pr_bacteria 2864745180 2864745267 398
48 iso_pr_bacteria 2864826666 2864827171 398
49 iso_pr_bacteria 2864847319 2864852181 398
50 iso_pr_bacteria 2864853652 2864858250 398
51 iso_pr_bacteria 2864903489 2864904222 398
52 iso_pr_bacteria 2864926767 2864929324 398
53 iso_pr_bacteria 2864937364 2864938434 398
54 iso_pr_bacteria 2864944480 2864946457 398
55 iso_pr_bacteria 2868169047 2868169899 398
56 iso_pr_bacteria 2873565274 2873567740 398
57 iso_pr_bacteria 2873571580 2873576003 398
58 iso_pr_bacteria 2987233858 2987235801 398
59 iso_pr_bacteria 2997878596 2997878852 398
60 iso_pr_bacteria 3007473699 3007476276 398
61 iso_pr_bacteria 3007478678 3007483114 398
62 iso_pr_bacteria 637000219 638000680 398
63 iso_pr_bacteria 8011329375 8011333529 398
64 iso_pr_bacteria 8011357093 8011358646 398
65 iso_pr_bacteria 8024031916 8024032874 398
66 iso_pr_bacteria 8035321120 8035323580 398
67 iso_pr_bacteria 8035326735 8035329874 398
68 iso_pr_bacteria 8035422605 8035422773 398
69 iso_pr_bacteria 8052469819 8052474567 398
70 iso_pr_bacteria 8100449422 8100455016 398
71 iso_pr_bacteria 8100455565 8100461557 398
72 iso_pr_bacteria 8100461708 8100464911 398
73 3300002931 CVPL010W_10016161 CVPL010W_100161612 399
74 3300002934 CVPL005W_1000116 CVPL005W_100011626 399
75 3300007042 Ga0103263_100382 Ga0103263_1003823 399
76 3300007067 Ga0103266_1000078 Ga0103266_10000788 399
77 3300007067 Ga0103266_1000381 Ga0103266_10003817 399
78 3300007068 Ga0103265_1000321 Ga0103265_10003218 399
79 3300007080 Ga0102735_1000086 Ga0102735_10000866 399
80 3300007129 Ga0102734_1000771 Ga0102734_10007718 399
81 3300007139 Ga0103260_1005467 Ga0103260_10054672 399
82 3300007141 Ga0102738_1000749 Ga0102738_10007495 399
83 3300007188 Ga0103264_1001896 Ga0103264_10018963 399
84 3300007190 Ga0103267_1000052 Ga0103267_100005210 399
85 3300007192 Ga0103268_1000020 Ga0103268_100002048 399
86 3300007192 Ga0103268_1000574 Ga0103268_10005745 399
87 3300007505 Ga0105005_1017883 Ga0105005_10178835 399
88 3300010882 Ga0123354_10018125 Ga0123354_100181259 399
89 3300012806 Ga0160442_100103 Ga0160442_1001036 399
90 3300012813 Ga0160470_104168 Ga0160470_1041682 399
91 3300012814 Ga0160453_101378 Ga0160453_1013782 399
92 3300012820 Ga0160456_100293 Ga0160456_1002938 399
93 3300012828 Ga0160431_101034 Ga0160431_1010342 399
94 3300012829 Ga0160467_101235 Ga0160467_10123512 399
95 3300012831 Ga0160459_100057 Ga0160459_10005791 399
96 3300012835 Ga0160446_100070 Ga0160446_100070108 399
97 3300012839 Ga0160472_101149 Ga0160472_1011493 399
98 3300012841 Ga0160444_100184 Ga0160444_10018454 399
99 3300012845 Ga0160460_102140 Ga0160460_1021403 399
100 3300012845 Ga0160460_103930 Ga0160460_1039301 399
101 3300012846 Ga0160433_100062 Ga0160433_10006212 399
102 3300012849 Ga0160447_105276 Ga0160447_1052762 399
103 3300012850 Ga0160434_103287 Ga0160434_1032872 399
104 3300012857 Ga0160435_1000255 Ga0160435_10002554 399
105 3300012861 Ga0160436_1005600 Ga0160436_10056002 399
106 3300042598 Ga0466701_050835 Ga0466701_050835_84314_85513 399
107 3300042617 Ga0466718_063200 Ga0466718_063200_2440_3639 399
108 3300042625 Ga0466730_070891 Ga0466730_070891_1654_2853 399
109 iso_pr_bacteria 2597489944 2598057124 399
110 iso_pr_bacteria 2834230000 2834230310 399
111 iso_pr_bacteria 2864870719 2864874688 399
112 iso_pr_bacteria 2864960361 2864964338 399
113 iso_pr_bacteria 3003869270 3003871478 399
114 iso_pr_bacteria 3003878002 3003880342 399
115 iso_pr_bacteria 8023724303 8023729123 399
116 iso_pr_bacteria 8023747282 8023752233 399
117 iso_pr_bacteria 8023752828 8023755481 399
118 iso_pr_bacteria 8023757577 8023762397 399
119 iso_pr_bacteria 8023764196 8023767556 399
120 iso_pr_bacteria 8024001094 8024002118 399
121 iso_pr_bacteria 8024014383 8024015322 399
122 iso_pr_bacteria 8024019580 8024021435 399
123 iso_pr_bacteria 8024025509 8024027336 399
124 iso_pr_bacteria 8024037630 8024038591 399
125 iso_pr_bacteria 8024044713 8024045682 399
126 iso_pr_bacteria 8025650824 8025651778 399
127 iso_pr_bacteria 8025658853 8025660151 399
128 iso_pr_bacteria 8025666332 8025667308 399
129 iso_pr_bacteria 8025671076 8025672069 399
130 iso_pr_bacteria 8025678175 8025679148 399
131 iso_pr_bacteria 8025685901 8025687292 399
132 iso_pr_bacteria 8025694439 8025695481 399
133 iso_pr_bacteria 8025701579 8025707253 399
134 iso_pr_bacteria 8025708040 8025709098 399
135 iso_pr_bacteria 8025716094 8025717371 399
136 iso_pr_bacteria 8025723035 8025723960 399
137 iso_pr_bacteria 8025728939 8025730045 399
138 iso_pr_bacteria 8025735396 8025737968 399
139 iso_pr_bacteria 8025740903 8025741860 399
140 iso_pr_bacteria 8025747911 8025748971 399
141 iso_pr_bacteria 8025756023 8025757083 399
142 iso_pr_bacteria 8069748016 8069750898 399
143 iso_pr_bacteria 8069755105 8069756165 399
144 iso_pr_bacteria 8069763219 8069764176 399
145 iso_pr_bacteria 8069770227 8069775178 399
146 iso_pr_bacteria 8069775773 8069778426 399
147 iso_pr_bacteria 8078130113 8078131136 399
148 iso_pr_bacteria 8101951471 8101952463 399
149 iso_pr_bacteria 8101960468 8101961462 399
150 iso_pr_bacteria 8101967387 8101968380 399
151 iso_pr_bacteria 8101974301 8101975300 399
152 iso_pr_bacteria 8101981714 8101982769 399
153 iso_pr_bacteria 8101988189 8101989324 399
154 iso_pr_bacteria 8101994502 8101995774 399
155 iso_pr_bacteria 8102001125 8102002036 399
156 iso_pr_bacteria 8102007614 8102008608 399
157 iso_pr_bacteria 8102014801 8102015790 399
158 iso_pr_bacteria 8102020860 8102022200 399
159 iso_pr_bacteria 8102026984 8102028088 399
160 iso_pr_bacteria 8102033761 8102035011 399
161 iso_pr_bacteria 8102041249 8102042220 399
162 iso_pr_bacteria 8102047609 8102048749 399
163 iso_pr_bacteria 8102054868 8102055887 399
164 iso_pr_bacteria 8102060671 8102061877 399
165 iso_pr_bacteria 8102067727 8102068803 399
166 iso_pr_bacteria 8102074813 8102075944 399
167 iso_pr_bacteria 8102081745 8102082887 399
168 iso_pr_bacteria 8102087471 8102088515 399
169 iso_pr_bacteria 8102094248 8102095555 399
170 iso_pr_bacteria 8102102351 8102103339 399
171 iso_pr_bacteria 8102109360 8102110364 399
172 iso_pr_bacteria 8102117041 8102117997 399
173 iso_pr_bacteria 8102124461 8102125620 399
174 iso_pr_bacteria 8102131453 8102131687 399
175 iso_pr_bacteria 8102138357 8102139314 399
176 iso_pr_bacteria 8102145433 8102150253 399
177 iso_pr_bacteria 8102152052 8102155412 399
178 iso_pr_bacteria 8102161003 8102165873 399
179 iso_pr_bacteria 8102169119 8102171691 399
180 iso_pr_bacteria 8102174626 8102175732 399
181 iso_pr_bacteria 8102181083 8102182008 399
182 iso_pr_bacteria 8102186987 8102188265 399
183 iso_pr_bacteria 8102193924 8102194981 399
184 iso_pr_bacteria 8102201977 8102207651 399
185 iso_pr_bacteria 8102208438 8102209392 399
186 iso_pr_bacteria 8102216467 8102217509 399
187 iso_pr_bacteria 8102223607 8102224600 399
188 iso_pr_bacteria 8102230706 8102232097 399
189 iso_pr_bacteria 8102239244 8102240216 399
190 iso_pr_bacteria 8102246966 8102247942 399
191 iso_pr_bacteria 8102251710 8102253008 399
192 iso_pr_bacteria 8102264549 8102265650 399
193 iso_pr_bacteria 8102271933 8102273111 399
194 iso_pr_bacteria 8102279326 8102280301 399
195 iso_pr_bacteria 8102286609 8102287823 399
196 iso_pr_bacteria 8102312426 8102313425 399
197 3300007080 Ga0102735_1000050 Ga0102735_10000507 400
198 3300007188 Ga0103264_1000231 Ga0103264_100023120 400
199 3300007190 Ga0103267_1000054 Ga0103267_100005439 400
200 3300007192 Ga0103268_1000041 Ga0103268_100004139 400
201 3300012798 Ga0160454_100472 Ga0160454_10047211 400
202 3300012812 Ga0160471_101249 Ga0160471_1012493 400
203 3300012813 Ga0160470_100065 Ga0160470_100065147 400
204 3300012829 Ga0160467_100193 Ga0160467_10019372 400
205 3300012834 Ga0160452_100019 Ga0160452_100019283 400
206 3300012849 Ga0160447_100704 Ga0160447_1007047 400
207 3300042582 Ga0466657_045754 Ga0466657_045754_3255_4457 400
208 3300042582 Ga0466657_398284 Ga0466657_398284_4895_6097 400
209 3300042596 Ga0466696_012277 Ga0466696_012277_1314_2516 400
210 3300042604 Ga0466717_011554 Ga0466717_011554_2208_3410 400
211 3300042612 Ga0466705_460685 Ga0466705_460685_15032_16234 400
212 3300042615 Ga0466711_432945 Ga0466711_432945_1429_2631 400
213 3300042619 Ga0466726_411884 Ga0466726_411884_1319_2521 400
214 3300042620 Ga0466728_090779 Ga0466728_090779_1536_2738 400
215 3300042623 Ga0466734_080504 Ga0466734_080504_1651_2853 400
216 3300042635 Ga0466702_257329 Ga0466702_257329_32_1234 400
217 3300042636 Ga0466703_197512 Ga0466703_197512_1586_2788 400
218 3300042654 Ga0466725_257671 Ga0466725_257671_414_1616 400
219 iso_pr_bacteria 2820042117 2820042936 400
220 iso_pr_bacteria 2820050117 2820052043 400
221 iso_pr_bacteria 2820062699 2820063267 400
222 iso_pr_bacteria 2820065746 2820067350 400
223 iso_pr_bacteria 2820089333 2820090435 400
224 iso_pr_bacteria 2820121232 2820121583 400
225 iso_pr_bacteria 2864751016 2864751475 400
226 iso_pr_bacteria 2864968865 2864972337 400
227 3300002462 JGI24702J35022_10000771 JGI24702J35022_100007717 401
228 3300002464 Meta3P_1003579 Meta3P_10035791 401
229 3300002504 JGI24705J35276_12234412 JGI24705J35276_122344123 401
230 3300010882 Ga0123354_10010422 Ga0123354_100104227 401
231 3300010882 Ga0123354_10113368 Ga0123354_101133682 401
232 3300042595 Ga0466695_113437 Ga0466695_113437_564_1769 401
233 3300042598 Ga0466701_089458 Ga0466701_089458_354_1559 401
234 3300042613 Ga0466710_075927 Ga0466710_075927_2545_3750 401
235 3300042614 Ga0466712_156454 Ga0466712_156454_21_1226 401
236 3300042615 Ga0466711_137279 Ga0466711_137279_13384_14589 401
237 3300042621 Ga0466729_130197 Ga0466729_130197_70438_71643 401
238 3300042652 Ga0466708_087100 Ga0466708_087100_5260_6465 401
239 3300042582 Ga0466657_340854 Ga0466657_340854_7382_8590 402
240 3300042613 Ga0466710_362546 Ga0466710_362546_88272_89480 402
241 3300042623 Ga0466734_133119 Ga0466734_133119_83_1291 402
242 3300042654 Ga0466725_033474 Ga0466725_033474_16803_18011 402
243 3300042654 Ga0466725_394896 Ga0466725_394896_105_1313 402
244 iso_pr_bacteria 2820084079 2820086037 402
245 iso_pr_bacteria 2820086750 2820089173 402
246 iso_pr_bacteria 2820123897 2820124600 402
247 iso_pr_bacteria 2820152154 2820153830 402
248 iso_pr_bacteria 2891720358 2891720726 402
249 3300009784 Ga0123357_10000008 Ga0123357_1000000871 403
250 3300010167 Ga0123353_10007002 Ga0123353_100070028 403
251 iso_pr_bacteria 2864755708 2864760019 403
252 iso_pr_bacteria 2864859030 2864860469 403
253 iso_pr_bacteria 2864914039 2864915510 403
254 iso_pr_bacteria 2820077244 2820077384 404
255 iso_pr_bacteria 2820157249 2820158535 404
256 iso_pr_bacteria 2820161938 2820163527 404
257 3300042654 Ga0466725_343028 Ga0466725_343028_167_1390 407
258 3300042596 Ga0466696_115564 Ga0466696_115564_2479_3726 415
259 3300012849 Ga0160447_104398 Ga0160447_1043983 452

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 82 447 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.