Protein Family IF03963

Metagenome Isolate
144 Members
99 Samples
107 Scaffolds
327.78 Avg Length

🧬 Representative Sequence

ID
3300012848|Ga0160443_100054|Ga0160443_100054142
Length
364 aa
Sequence
MIAFLFLPLCNSVALMKVFGGKYRKLNFKCCYLCPVEHVFSKPLFLNHSEENFNNLAIDVFRFQVTHNPVYASFVKGLRKDPELVSTVRDIPYMPVEFFKNHKVICGANTPGIVFSSSGTTGMIQSKHDVLDVSVYEESFRKTFKLFYGDIQDLVILALLPSYLERGSSSLIYMVEDLIQRTKNPDSGYFLYNHDELLQTLVKLRSAGRKVILIGVTYALLDFVEHYTLDFPDLIVMETGGMKGKRKEMIREELHQQLCAGFGVDAIHSEYGMTELLSQAYSSGKGLFRCPPWMRIDIRDINDPLSLLGTGATGGINVIDLGNIYSCSFIATQDLGKKHEDGSFEIIGRFDNSDIRGCNLLVQ*

πŸ“Š Sample Types

Isolate 25.7%
Metagenome 74.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 18.2%
Formicidae 12.5%
Elmidae 10.2%
Culicidae 10.2%
Armadillidiidae 8.0%
Unclassified 6.8%
Drosophilidae 5.7%
Apidae 5.7%
Kalotermitidae 3.4%
Rhinotermitidae 2.3%
Daphniidae 2.3%
Blattellidae 2.3%
Cambaridae 2.3%
Termopsidae 2.3%
Tenebrionidae 1.1%
Passalidae 1.1%
Hodotermitidae 1.1%
Bombycidae 1.1%
Hydrophilidae 1.1%
Nephropidae 1.1%
Ectobiidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
2 2896321640 Sphingobacterium sp. xlx-130 Isolate
3 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
6 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
7 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
8 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
12 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
13 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
14 2898741527 Sphingobacterium sp. xlx-73 Isolate
15 2904728850 Flavobacterium sp. xlx-214 Isolate
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
20 3002033046 Blattabacterium cuenoti ANALLAmet Isolate Blattellidae
21 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
22 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
25 2832372155 Apibacter adventoris wkB301 Isolate Apidae
26 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
27 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
28 2896330536 Sphingobacterium sp. xlx-96 Isolate
29 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
30 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
31 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
32 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
33 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
34 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
35 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
36 2832343623 Apibacter adventoris wkB180 Isolate Apidae
37 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
38 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
39 2882250448 Bizionia sp. APA-3 Isolate
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
43 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
44 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
45 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
46 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
47 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
48 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
49 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
50 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
51 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
52 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
53 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
54 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
55 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
58 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
59 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
60 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
61 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
62 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
63 2785510743 Apibacter sp. ESL0404 Isolate Apidae
64 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
65 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
68 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
69 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
70 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
71 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
72 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
73 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
74 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
75 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
76 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
77 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
78 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
79 2896350215 Sphingobacterium sp. xlx-183 Isolate
80 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
81 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
82 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
83 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
84 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
85 3002005847 Blattabacterium cuenoti ECTOBIsp Isolate Ectobiidae
86 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
87 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
88 2832298047 Apibacter sp. wkB309 Isolate Apidae
89 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
90 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
91 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
92 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
93 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
94 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
95 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
96 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
97 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
98 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
99 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160465_100011 3300012803 Bacteria 346564
2 Ga0160470_100073 3300012813 Bacteria 136037
3 Ga0466726_093868 3300042619 Bacteria 22465
4 Ga0466729_075047 3300042621 Bacteria 4454
5 Ga0466734_061300 3300042623 Bacteria 1320
6 Ga0466735_061864 3300042624 Unclassified 1606
7 Ga0160446_100133 3300012835 Bacteria 62364
8 Ga0466657_072158 3300042582 Bacteria 1893
9 Ga0466693_163279 3300042592 Bacteria 1290
10 Ga0466694_345345 3300042594 Bacteria 1797
11 Ga0466701_022128 3300042598 Bacteria 24867
12 Ga0466714_105890 3300042603 Bacteria 1227
13 Ga0466722_064945 3300042609 Bacteria 7141
14 Ga0466722_099617 3300042609 Bacteria 7541
15 Ga0102735_1000097 3300007080 Bacteria 23143
16 Ga0102739_1000011 3300007095 Bacteria 63975
17 Ga0123355_10521318 3300009826 Bacteria 1454
18 Ga0466711_294172 3300042615 Bacteria 5631
19 Ga0466718_128317 3300042617 Bacteria 3258
20 Ga0160433_100008 3300012846 Bacteria 311360
21 Ga0160443_100054 3300012848 Bacteria 237880
22 Ga0466698_445683 3300042610 Bacteria 1158
23 CVPL010W_10006115 3300002931 Bacteria 12518
24 Ga0068305_10736216 3300005083 Bacteria 3014
25 Ga0104045_1021785 3300007085 Bacteria 2217
26 Ga0102734_1001194 3300007129 Bacteria 6879
27 Ga0103267_1000867 3300007190 Bacteria 8402
28 Ga0466731_420901 3300042622 Bacteria 1802
29 Ga0466724_34931 3300042649 Bacteria 3988
30 Ga0160453_100001 3300012814 Bacteria 1272344
31 Ga0160468_105377 3300012819 Bacteria 1460
32 Ga0160469_100004 3300012824 Bacteria 821419
33 Ga0160467_100020 3300012829 Bacteria 315701
34 Ga0466696_022386 3300042596 Bacteria 14378
35 Ga0466701_050423 3300042598 Bacteria 264361
36 Ga0466713_081803 3300042602 Bacteria 17937
37 HBC_ctgsDRAFT_1000079 3300000333 Bacteria 24975
38 JGI24702J35022_10008713 3300002462 Bacteria 5727
39 Ga0104045_1019267 3300007085 Bacteria 6640
40 Ga0102740_1000353 3300007140 Bacteria 24576
41 Ga0104019_1000051 3300007150 Bacteria 21474
42 Ga0160472_100236 3300012839 Bacteria 65733
43 Ga0160472_104615 3300012839 Bacteria 2380
44 Ga0160433_102820 3300012846 Bacteria 3480
45 Ga0160445_109296 3300012847 Bacteria 1480
46 Ga0466707_242014 3300042601 Bacteria 35197
47 Ga0466722_014489 3300042609 Bacteria 15907
48 Ga0104045_1023322 3300007085 Unclassified 5954
49 Ga0104048_1002999 3300007143 Bacteria 4534
50 Ga0160468_100060 3300012819 Bacteria 151929
51 Ga0160433_100025 3300012846 Bacteria 185749
52 Ga0160457_1000732 3300012858 Bacteria 12173
53 Ga0466701_007873 3300042598 Bacteria 49689
54 Ga0466701_070792 3300042598 Bacteria 21694
55 Ga0466701_071843 3300042598 Unclassified 3468
56 Ga0466701_082307 3300042598 Bacteria 68565
57 Meta3P_1009319 3300002464 Unclassified 4464
58 Ga0102736_1000328 3300007052 Bacteria 10205
59 Ga0104045_1003556 3300007085 Bacteria 2684
60 Ga0102737_1000035 3300007142 Bacteria 38733
61 Ga0466733_025467 3300042659 Bacteria 34078
62 Ga0466711_251377 3300042615 Bacteria 11764
63 Ga0466730_030722 3300042625 Bacteria 1135247
64 Ga0466724_12613 3300042649 Bacteria 6755
65 Ga0466724_18996 3300042649 Bacteria 149746
66 Ga0466724_57428 3300042649 Bacteria 23143
67 Ga0160440_103179 3300012815 Bacteria 1620
68 Ga0160445_100410 3300012847 Unclassified 23354
69 Ga0160443_100077 3300012848 Bacteria 175780
70 Ga0160435_1000049 3300012857 Unclassified 88586
71 Ga0466706_127960 3300042599 Bacteria 71121
72 CVPL010W_10000328 3300002931 Bacteria 47517
73 Ga0074308_1113768 3300005307 Bacteria 2665
74 Ga0103265_1001581 3300007068 Bacteria 3659
75 Ga0102740_1000884 3300007140 Bacteria 8099
76 Ga0104048_1001207 3300007143 Bacteria 8414
77 Ga0103264_1000306 3300007188 Bacteria 53950
78 Ga0466733_151115 3300042659 Bacteria 9227
79 Ga0466729_279680 3300042621 Bacteria 7168
80 Ga0466730_097984 3300042625 Bacteria 727286
81 Ga0466703_096647 3300042636 Bacteria 1588
82 Ga0466724_43696 3300042649 Bacteria 561295
83 Ga0466725_284756 3300042654 Bacteria 27984
84 Ga0160432_100012 3300012818 Bacteria 390104
85 Ga0160441_100200 3300012825 Bacteria 60950
86 Ga0160457_1002723 3300012858 Unclassified 3454
87 Ga0466701_010917 3300042598 Bacteria 27125
88 Ga0466706_123047 3300042599 Bacteria 432554
89 Ga0074308_1114120 3300005307 Bacteria 2104
90 Ga0104045_1005732 3300007085 Unclassified 11866
91 Ga0104050_1002152 3300007153 Bacteria 16514
92 Ga0104050_1200432 3300007153 Bacteria 2340
93 Ga0104050_1200857 3300007153 Bacteria 2060
94 Ga0466710_162661 3300042613 Bacteria 3965
95 Ga0466703_057552 3300042636 Bacteria 2097
96 Ga0466724_23916 3300042649 Bacteria 557842
97 Ga0160467_100347 3300012829 Bacteria 49054
98 IMNBGM34_c006410 3300000036 Bacteria 1528
99 Ga0103265_1000011 3300007068 Bacteria 44046
100 Ga0102735_1000692 3300007080 Bacteria 8089
101 Ga0102734_1000603 3300007129 Bacteria 10028
102 Ga0104048_1026727 3300007143 Bacteria 3287
103 Ga0104048_1170152 3300007143 Bacteria 1754
104 Ga0104019_1003974 3300007150 Bacteria 7570
105 Ga0103267_1000709 3300007190 Unclassified 9077
106 Ga0103267_1004645 3300007190 Bacteria 3770
107 Ga0103268_1025236 3300007192 Bacteria 1372

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007143 Ga0104048_1170152 Ga0104048_11701521 264
2 3300042636 Ga0466703_096647 Ga0466703_096647_675_1562 295
3 3300042615 Ga0466711_251377 Ga0466711_251377_611_1591 301
4 3300042623 Ga0466734_061300 Ga0466734_061300_240_1232 302
5 3300042621 Ga0466729_279680 Ga0466729_279680_1655_2629 305
6 3300007192 Ga0103268_1025236 Ga0103268_10252361 311
7 3300042609 Ga0466722_099617 Ga0466722_099617_228_1217 317
8 3300007052 Ga0102736_1000328 Ga0102736_10003284 320
9 3300007190 Ga0103267_1000709 Ga0103267_10007097 320
10 3300042609 Ga0466722_064945 Ga0466722_064945_2474_3442 322
11 iso_pr_bacteria 3002005847 3002006118 322
12 iso_pr_bacteria 3002026852 3002027124 322
13 3300042601 Ga0466707_242014 Ga0466707_242014_7925_8899 324
14 3300042622 Ga0466731_420901 Ga0466731_420901_48_1022 324
15 iso_pr_bacteria 3002033046 3002033320 324
16 3300002931 CVPL010W_10000328 CVPL010W_100003283 325
17 3300005083 Ga0068305_10736216 Ga0068305_107362161 325
18 3300007085 Ga0104045_1005732 Ga0104045_10057322 325
19 3300007143 Ga0104048_1026727 Ga0104048_10267273 325
20 3300007150 Ga0104019_1000051 Ga0104019_100005115 325
21 3300042599 Ga0466706_123047 Ga0466706_123047_166821_167798 325
22 3300042617 Ga0466718_128317 Ga0466718_128317_741_1718 325
23 3300042649 Ga0466724_57428 Ga0466724_57428_8629_9606 325
24 3300042659 Ga0466733_151115 Ga0466733_151115_5331_6308 325
25 iso_pr_bacteria 2579779088 2582240191 325
26 3300002931 CVPL010W_10006115 CVPL010W_1000611514 326
27 3300007080 Ga0102735_1000097 Ga0102735_10000975 326
28 3300007085 Ga0104045_1019267 Ga0104045_10192673 326
29 3300007095 Ga0102739_1000011 Ga0102739_10000118 326
30 3300007129 Ga0102734_1000603 Ga0102734_10006033 326
31 3300007140 Ga0102740_1000353 Ga0102740_10003537 326
32 3300007142 Ga0102737_1000035 Ga0102737_100003512 326
33 3300007190 Ga0103267_1000867 Ga0103267_10008672 326
34 3300007190 Ga0103267_1004645 Ga0103267_10046451 326
35 3300012814 Ga0160453_100001 Ga0160453_100001669 326
36 3300012818 Ga0160432_100012 Ga0160432_100012319 326
37 3300012819 Ga0160468_100060 Ga0160468_100060107 326
38 3300012829 Ga0160467_100347 Ga0160467_10034726 326
39 3300012846 Ga0160433_100025 Ga0160433_1000257 326
40 3300012846 Ga0160433_102820 Ga0160433_1028203 326
41 3300012847 Ga0160445_100410 Ga0160445_1004103 326
42 3300012858 Ga0160457_1002723 Ga0160457_10027233 326
43 3300042598 Ga0466701_007873 Ga0466701_007873_45271_46251 326
44 3300042598 Ga0466701_010917 Ga0466701_010917_16038_17018 326
45 3300042598 Ga0466701_070792 Ga0466701_070792_19028_20008 326
46 3300042598 Ga0466701_071843 Ga0466701_071843_1576_2556 326
47 3300042615 Ga0466711_294172 Ga0466711_294172_3149_4129 326
48 3300042624 Ga0466735_061864 Ga0466735_061864_424_1404 326
49 3300042625 Ga0466730_030722 Ga0466730_030722_797501_798481 326
50 3300042636 Ga0466703_057552 Ga0466703_057552_731_1711 326
51 3300042649 Ga0466724_12613 Ga0466724_12613_923_1903 326
52 3300042649 Ga0466724_18996 Ga0466724_18996_33969_34949 326
53 3300042649 Ga0466724_23916 Ga0466724_23916_425441_426421 326
54 3300042649 Ga0466724_34931 Ga0466724_34931_1030_2010 326
55 iso_pr_bacteria 2785510743 2785736235 326
56 iso_pr_bacteria 2799112231 2799234186 326
57 iso_pr_bacteria 2811995047 2812946867 326
58 iso_pr_bacteria 2832298047 2832299454 326
59 iso_pr_bacteria 2832343623 2832345282 326
60 iso_pr_bacteria 2832372155 2832373594 326
61 iso_pr_bacteria 2838772460 2838773300 326
62 iso_pr_bacteria 2864878056 2864878125 326
63 iso_pr_bacteria 2864886855 2864888189 326
64 iso_pr_bacteria 2882250448 2882251729 326
65 iso_pr_bacteria 2896321640 2896324620 326
66 iso_pr_bacteria 2896330536 2896334185 326
67 iso_pr_bacteria 2896350215 2896353804 326
68 iso_pr_bacteria 2898741527 2898744918 326
69 iso_pr_bacteria 2899132286 2899135110 326
70 iso_pr_bacteria 2904728850 2904731361 326
71 iso_pr_bacteria 2958471994 2958474445 326
72 3300000333 HBC_ctgsDRAFT_1000079 HBC_ctgsDRAFT_10000797 327
73 3300007085 Ga0104045_1003556 Ga0104045_10035562 327
74 3300007085 Ga0104045_1021785 Ga0104045_10217853 327
75 3300007150 Ga0104019_1003974 Ga0104019_10039746 327
76 3300012824 Ga0160469_100004 Ga0160469_100004223 327
77 3300012848 Ga0160443_100077 Ga0160443_10007772 327
78 3300042596 Ga0466696_022386 Ga0466696_022386_2768_3751 327
79 3300042598 Ga0466701_050423 Ga0466701_050423_3691_4674 327
80 3300042598 Ga0466701_082307 Ga0466701_082307_49967_50950 327
81 iso_pr_bacteria 2590828803 2592929423 327
82 iso_pr_bacteria 2864822740 2864826125 327
83 iso_pr_bacteria 2864882932 2864886468 327
84 iso_pr_bacteria 2873776654 2873780200 327
85 3300005307 Ga0074308_1114120 Ga0074308_11141202 328
86 3300007085 Ga0104045_1023322 Ga0104045_10233223 328
87 3300007143 Ga0104048_1001207 Ga0104048_10012075 328
88 3300007143 Ga0104048_1002999 Ga0104048_10029997 328
89 3300007153 Ga0104050_1200432 Ga0104050_12004323 328
90 3300012803 Ga0160465_100011 Ga0160465_100011120 328
91 3300012825 Ga0160441_100200 Ga0160441_10020014 328
92 3300012835 Ga0160446_100133 Ga0160446_10013314 328
93 3300012839 Ga0160472_100236 Ga0160472_10023633 328
94 3300012839 Ga0160472_104615 Ga0160472_1046152 328
95 3300012857 Ga0160435_1000049 Ga0160435_100004958 328
96 3300042592 Ga0466693_163279 Ga0466693_163279_279_1265 328
97 3300042609 Ga0466722_014489 Ga0466722_014489_12279_13265 328
98 3300042610 Ga0466698_445683 Ga0466698_445683_94_1080 328
99 3300042619 Ga0466726_093868 Ga0466726_093868_18647_19633 328
100 3300042659 Ga0466733_025467 Ga0466733_025467_13409_14395 328
101 iso_pr_bacteria 2894649344 2894650276 328
102 3300000036 IMNBGM34_c006410 IMNBGM34_0064102 329
103 3300007153 Ga0104050_1002152 Ga0104050_100215213 329
104 3300009826 Ga0123355_10521318 Ga0123355_105213182 329
105 3300012813 Ga0160470_100073 Ga0160470_10007329 329
106 3300012815 Ga0160440_103179 Ga0160440_1031792 329
107 3300012829 Ga0160467_100020 Ga0160467_100020107 329
108 3300012846 Ga0160433_100008 Ga0160433_100008127 329
109 3300012847 Ga0160445_109296 Ga0160445_1092962 329
110 3300012858 Ga0160457_1000732 Ga0160457_10007324 329
111 3300042594 Ga0466694_345345 Ga0466694_345345_408_1397 329
112 3300042599 Ga0466706_127960 Ga0466706_127960_35193_36182 329
113 3300042602 Ga0466713_081803 Ga0466713_081803_2454_3443 329
114 iso_pr_bacteria 2864891731 2864893319 329
115 3300042625 Ga0466730_097984 Ga0466730_097984_399158_400150 330
116 iso_pr_bacteria 2687453786 2690170491 330
117 iso_pr_bacteria 2864831662 2864834265 330
118 3300007129 Ga0102734_1001194 Ga0102734_10011944 332
119 3300042621 Ga0466729_075047 Ga0466729_075047_3301_4302 333
120 3300042649 Ga0466724_43696 Ga0466724_43696_155539_156543 334
121 iso_pr_bacteria 2529292732 2529761238 334
122 iso_pr_bacteria 2847090942 2847093946 334
123 iso_pr_bacteria 2864788197 2864790538 334
124 iso_pr_bacteria 2864923010 2864925352 334
125 iso_pr_bacteria 2864948220 2864950560 334
126 iso_pr_bacteria 8020009074 8020012259 334
127 iso_pr_bacteria 8114076984 8114077576 334
128 3300002464 Meta3P_1009319 Meta3P_10093194 335
129 3300007068 Ga0103265_1000011 Ga0103265_100001131 338
130 3300007188 Ga0103264_1000306 Ga0103264_100030627 338
131 3300007068 Ga0103265_1001581 Ga0103265_10015812 339
132 3300007080 Ga0102735_1000692 Ga0102735_10006927 339
133 3300005307 Ga0074308_1113768 Ga0074308_11137684 340
134 3300007140 Ga0102740_1000884 Ga0102740_10008842 340
135 3300007153 Ga0104050_1200857 Ga0104050_12008573 340
136 3300012819 Ga0160468_105377 Ga0160468_1053772 340
137 3300042603 Ga0466714_105890 Ga0466714_105890_66_1091 341
138 3300042613 Ga0466710_162661 Ga0466710_162661_192_1220 342
139 3300002462 JGI24702J35022_10008713 JGI24702J35022_100087135 345
140 iso_pr_bacteria 2921902974 2921905062 347
141 3300042654 Ga0466725_284756 Ga0466725_284756_22190_23239 349
142 3300042582 Ga0466657_072158 Ga0466657_072158_712_1764 350
143 3300042598 Ga0466701_022128 Ga0466701_022128_1794_2885 363
144 3300012848 Ga0160443_100054 Ga0160443_100054142 364

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04443 LuxE Acyl-protein synthetase, LuxE 44 361 0.79

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.