Protein Family IF03963
Metagenome
Isolate
144
Members
99
Samples
107
Scaffolds
327.78
Avg Length
Representative Sequence
- ID
- 3300012848|Ga0160443_100054|Ga0160443_100054142
- Length
- 364 aa
- Sequence
- MIAFLFLPLCNSVALMKVFGGKYRKLNFKCCYLCPVEHVFSKPLFLNHSEENFNNLAIDVFRFQVTHNPVYASFVKGLRKDPELVSTVRDIPYMPVEFFKNHKVICGANTPGIVFSSSGTTGMIQSKHDVLDVSVYEESFRKTFKLFYGDIQDLVILALLPSYLERGSSSLIYMVEDLIQRTKNPDSGYFLYNHDELLQTLVKLRSAGRKVILIGVTYALLDFVEHYTLDFPDLIVMETGGMKGKRKEMIREELHQQLCAGFGVDAIHSEYGMTELLSQAYSSGKGLFRCPPWMRIDIRDINDPLSLLGTGATGGINVIDLGNIYSCSFIATQDLGKKHEDGSFEIIGRFDNSDIRGCNLLVQ*
Sample Types
Isolate
25.7%
Metagenome
74.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
18.2%
Formicidae
12.5%
Elmidae
10.2%
Culicidae
10.2%
Armadillidiidae
8.0%
Unclassified
6.8%
Drosophilidae
5.7%
Apidae
5.7%
Kalotermitidae
3.4%
Rhinotermitidae
2.3%
Daphniidae
2.3%
Blattellidae
2.3%
Cambaridae
2.3%
Termopsidae
2.3%
Tenebrionidae
1.1%
Passalidae
1.1%
Hodotermitidae
1.1%
Bombycidae
1.1%
Hydrophilidae
1.1%
Nephropidae
1.1%
Ectobiidae
1.1%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 2 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 3 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 6 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 7 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 8 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 12 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 13 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 14 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 15 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 20 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 21 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 22 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 25 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 26 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 27 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 28 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 29 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 30 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 31 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 32 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 33 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 34 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 35 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 36 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 37 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 38 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 39 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 40 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 43 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 44 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 45 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 46 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 47 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 48 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 49 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 50 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 54 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 55 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 61 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 62 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 63 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 64 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 65 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 68 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 69 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 70 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 71 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 74 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 75 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 76 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 77 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 78 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 79 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 82 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 83 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 84 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 85 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 86 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 87 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 88 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 89 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 90 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 91 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 92 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 93 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 94 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 95 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 96 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 97 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 98 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 99 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160465_100011 | 3300012803 | Bacteria | 346564 |
| 2 | Ga0160470_100073 | 3300012813 | Bacteria | 136037 |
| 3 | Ga0466726_093868 | 3300042619 | Bacteria | 22465 |
| 4 | Ga0466729_075047 | 3300042621 | Bacteria | 4454 |
| 5 | Ga0466734_061300 | 3300042623 | Bacteria | 1320 |
| 6 | Ga0466735_061864 | 3300042624 | Unclassified | 1606 |
| 7 | Ga0160446_100133 | 3300012835 | Bacteria | 62364 |
| 8 | Ga0466657_072158 | 3300042582 | Bacteria | 1893 |
| 9 | Ga0466693_163279 | 3300042592 | Bacteria | 1290 |
| 10 | Ga0466694_345345 | 3300042594 | Bacteria | 1797 |
| 11 | Ga0466701_022128 | 3300042598 | Bacteria | 24867 |
| 12 | Ga0466714_105890 | 3300042603 | Bacteria | 1227 |
| 13 | Ga0466722_064945 | 3300042609 | Bacteria | 7141 |
| 14 | Ga0466722_099617 | 3300042609 | Bacteria | 7541 |
| 15 | Ga0102735_1000097 | 3300007080 | Bacteria | 23143 |
| 16 | Ga0102739_1000011 | 3300007095 | Bacteria | 63975 |
| 17 | Ga0123355_10521318 | 3300009826 | Bacteria | 1454 |
| 18 | Ga0466711_294172 | 3300042615 | Bacteria | 5631 |
| 19 | Ga0466718_128317 | 3300042617 | Bacteria | 3258 |
| 20 | Ga0160433_100008 | 3300012846 | Bacteria | 311360 |
| 21 | Ga0160443_100054 | 3300012848 | Bacteria | 237880 |
| 22 | Ga0466698_445683 | 3300042610 | Bacteria | 1158 |
| 23 | CVPL010W_10006115 | 3300002931 | Bacteria | 12518 |
| 24 | Ga0068305_10736216 | 3300005083 | Bacteria | 3014 |
| 25 | Ga0104045_1021785 | 3300007085 | Bacteria | 2217 |
| 26 | Ga0102734_1001194 | 3300007129 | Bacteria | 6879 |
| 27 | Ga0103267_1000867 | 3300007190 | Bacteria | 8402 |
| 28 | Ga0466731_420901 | 3300042622 | Bacteria | 1802 |
| 29 | Ga0466724_34931 | 3300042649 | Bacteria | 3988 |
| 30 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 31 | Ga0160468_105377 | 3300012819 | Bacteria | 1460 |
| 32 | Ga0160469_100004 | 3300012824 | Bacteria | 821419 |
| 33 | Ga0160467_100020 | 3300012829 | Bacteria | 315701 |
| 34 | Ga0466696_022386 | 3300042596 | Bacteria | 14378 |
| 35 | Ga0466701_050423 | 3300042598 | Bacteria | 264361 |
| 36 | Ga0466713_081803 | 3300042602 | Bacteria | 17937 |
| 37 | HBC_ctgsDRAFT_1000079 | 3300000333 | Bacteria | 24975 |
| 38 | JGI24702J35022_10008713 | 3300002462 | Bacteria | 5727 |
| 39 | Ga0104045_1019267 | 3300007085 | Bacteria | 6640 |
| 40 | Ga0102740_1000353 | 3300007140 | Bacteria | 24576 |
| 41 | Ga0104019_1000051 | 3300007150 | Bacteria | 21474 |
| 42 | Ga0160472_100236 | 3300012839 | Bacteria | 65733 |
| 43 | Ga0160472_104615 | 3300012839 | Bacteria | 2380 |
| 44 | Ga0160433_102820 | 3300012846 | Bacteria | 3480 |
| 45 | Ga0160445_109296 | 3300012847 | Bacteria | 1480 |
| 46 | Ga0466707_242014 | 3300042601 | Bacteria | 35197 |
| 47 | Ga0466722_014489 | 3300042609 | Bacteria | 15907 |
| 48 | Ga0104045_1023322 | 3300007085 | Unclassified | 5954 |
| 49 | Ga0104048_1002999 | 3300007143 | Bacteria | 4534 |
| 50 | Ga0160468_100060 | 3300012819 | Bacteria | 151929 |
| 51 | Ga0160433_100025 | 3300012846 | Bacteria | 185749 |
| 52 | Ga0160457_1000732 | 3300012858 | Bacteria | 12173 |
| 53 | Ga0466701_007873 | 3300042598 | Bacteria | 49689 |
| 54 | Ga0466701_070792 | 3300042598 | Bacteria | 21694 |
| 55 | Ga0466701_071843 | 3300042598 | Unclassified | 3468 |
| 56 | Ga0466701_082307 | 3300042598 | Bacteria | 68565 |
| 57 | Meta3P_1009319 | 3300002464 | Unclassified | 4464 |
| 58 | Ga0102736_1000328 | 3300007052 | Bacteria | 10205 |
| 59 | Ga0104045_1003556 | 3300007085 | Bacteria | 2684 |
| 60 | Ga0102737_1000035 | 3300007142 | Bacteria | 38733 |
| 61 | Ga0466733_025467 | 3300042659 | Bacteria | 34078 |
| 62 | Ga0466711_251377 | 3300042615 | Bacteria | 11764 |
| 63 | Ga0466730_030722 | 3300042625 | Bacteria | 1135247 |
| 64 | Ga0466724_12613 | 3300042649 | Bacteria | 6755 |
| 65 | Ga0466724_18996 | 3300042649 | Bacteria | 149746 |
| 66 | Ga0466724_57428 | 3300042649 | Bacteria | 23143 |
| 67 | Ga0160440_103179 | 3300012815 | Bacteria | 1620 |
| 68 | Ga0160445_100410 | 3300012847 | Unclassified | 23354 |
| 69 | Ga0160443_100077 | 3300012848 | Bacteria | 175780 |
| 70 | Ga0160435_1000049 | 3300012857 | Unclassified | 88586 |
| 71 | Ga0466706_127960 | 3300042599 | Bacteria | 71121 |
| 72 | CVPL010W_10000328 | 3300002931 | Bacteria | 47517 |
| 73 | Ga0074308_1113768 | 3300005307 | Bacteria | 2665 |
| 74 | Ga0103265_1001581 | 3300007068 | Bacteria | 3659 |
| 75 | Ga0102740_1000884 | 3300007140 | Bacteria | 8099 |
| 76 | Ga0104048_1001207 | 3300007143 | Bacteria | 8414 |
| 77 | Ga0103264_1000306 | 3300007188 | Bacteria | 53950 |
| 78 | Ga0466733_151115 | 3300042659 | Bacteria | 9227 |
| 79 | Ga0466729_279680 | 3300042621 | Bacteria | 7168 |
| 80 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 81 | Ga0466703_096647 | 3300042636 | Bacteria | 1588 |
| 82 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 83 | Ga0466725_284756 | 3300042654 | Bacteria | 27984 |
| 84 | Ga0160432_100012 | 3300012818 | Bacteria | 390104 |
| 85 | Ga0160441_100200 | 3300012825 | Bacteria | 60950 |
| 86 | Ga0160457_1002723 | 3300012858 | Unclassified | 3454 |
| 87 | Ga0466701_010917 | 3300042598 | Bacteria | 27125 |
| 88 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 89 | Ga0074308_1114120 | 3300005307 | Bacteria | 2104 |
| 90 | Ga0104045_1005732 | 3300007085 | Unclassified | 11866 |
| 91 | Ga0104050_1002152 | 3300007153 | Bacteria | 16514 |
| 92 | Ga0104050_1200432 | 3300007153 | Bacteria | 2340 |
| 93 | Ga0104050_1200857 | 3300007153 | Bacteria | 2060 |
| 94 | Ga0466710_162661 | 3300042613 | Bacteria | 3965 |
| 95 | Ga0466703_057552 | 3300042636 | Bacteria | 2097 |
| 96 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 97 | Ga0160467_100347 | 3300012829 | Bacteria | 49054 |
| 98 | IMNBGM34_c006410 | 3300000036 | Bacteria | 1528 |
| 99 | Ga0103265_1000011 | 3300007068 | Bacteria | 44046 |
| 100 | Ga0102735_1000692 | 3300007080 | Bacteria | 8089 |
| 101 | Ga0102734_1000603 | 3300007129 | Bacteria | 10028 |
| 102 | Ga0104048_1026727 | 3300007143 | Bacteria | 3287 |
| 103 | Ga0104048_1170152 | 3300007143 | Bacteria | 1754 |
| 104 | Ga0104019_1003974 | 3300007150 | Bacteria | 7570 |
| 105 | Ga0103267_1000709 | 3300007190 | Unclassified | 9077 |
| 106 | Ga0103267_1004645 | 3300007190 | Bacteria | 3770 |
| 107 | Ga0103268_1025236 | 3300007192 | Bacteria | 1372 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007143 | Ga0104048_1170152 | Ga0104048_11701521 | 264 |
| 2 | 3300042636 | Ga0466703_096647 | Ga0466703_096647_675_1562 | 295 |
| 3 | 3300042615 | Ga0466711_251377 | Ga0466711_251377_611_1591 | 301 |
| 4 | 3300042623 | Ga0466734_061300 | Ga0466734_061300_240_1232 | 302 |
| 5 | 3300042621 | Ga0466729_279680 | Ga0466729_279680_1655_2629 | 305 |
| 6 | 3300007192 | Ga0103268_1025236 | Ga0103268_10252361 | 311 |
| 7 | 3300042609 | Ga0466722_099617 | Ga0466722_099617_228_1217 | 317 |
| 8 | 3300007052 | Ga0102736_1000328 | Ga0102736_10003284 | 320 |
| 9 | 3300007190 | Ga0103267_1000709 | Ga0103267_10007097 | 320 |
| 10 | 3300042609 | Ga0466722_064945 | Ga0466722_064945_2474_3442 | 322 |
| 11 | iso_pr_bacteria | 3002005847 | 3002006118 | 322 |
| 12 | iso_pr_bacteria | 3002026852 | 3002027124 | 322 |
| 13 | 3300042601 | Ga0466707_242014 | Ga0466707_242014_7925_8899 | 324 |
| 14 | 3300042622 | Ga0466731_420901 | Ga0466731_420901_48_1022 | 324 |
| 15 | iso_pr_bacteria | 3002033046 | 3002033320 | 324 |
| 16 | 3300002931 | CVPL010W_10000328 | CVPL010W_100003283 | 325 |
| 17 | 3300005083 | Ga0068305_10736216 | Ga0068305_107362161 | 325 |
| 18 | 3300007085 | Ga0104045_1005732 | Ga0104045_10057322 | 325 |
| 19 | 3300007143 | Ga0104048_1026727 | Ga0104048_10267273 | 325 |
| 20 | 3300007150 | Ga0104019_1000051 | Ga0104019_100005115 | 325 |
| 21 | 3300042599 | Ga0466706_123047 | Ga0466706_123047_166821_167798 | 325 |
| 22 | 3300042617 | Ga0466718_128317 | Ga0466718_128317_741_1718 | 325 |
| 23 | 3300042649 | Ga0466724_57428 | Ga0466724_57428_8629_9606 | 325 |
| 24 | 3300042659 | Ga0466733_151115 | Ga0466733_151115_5331_6308 | 325 |
| 25 | iso_pr_bacteria | 2579779088 | 2582240191 | 325 |
| 26 | 3300002931 | CVPL010W_10006115 | CVPL010W_1000611514 | 326 |
| 27 | 3300007080 | Ga0102735_1000097 | Ga0102735_10000975 | 326 |
| 28 | 3300007085 | Ga0104045_1019267 | Ga0104045_10192673 | 326 |
| 29 | 3300007095 | Ga0102739_1000011 | Ga0102739_10000118 | 326 |
| 30 | 3300007129 | Ga0102734_1000603 | Ga0102734_10006033 | 326 |
| 31 | 3300007140 | Ga0102740_1000353 | Ga0102740_10003537 | 326 |
| 32 | 3300007142 | Ga0102737_1000035 | Ga0102737_100003512 | 326 |
| 33 | 3300007190 | Ga0103267_1000867 | Ga0103267_10008672 | 326 |
| 34 | 3300007190 | Ga0103267_1004645 | Ga0103267_10046451 | 326 |
| 35 | 3300012814 | Ga0160453_100001 | Ga0160453_100001669 | 326 |
| 36 | 3300012818 | Ga0160432_100012 | Ga0160432_100012319 | 326 |
| 37 | 3300012819 | Ga0160468_100060 | Ga0160468_100060107 | 326 |
| 38 | 3300012829 | Ga0160467_100347 | Ga0160467_10034726 | 326 |
| 39 | 3300012846 | Ga0160433_100025 | Ga0160433_1000257 | 326 |
| 40 | 3300012846 | Ga0160433_102820 | Ga0160433_1028203 | 326 |
| 41 | 3300012847 | Ga0160445_100410 | Ga0160445_1004103 | 326 |
| 42 | 3300012858 | Ga0160457_1002723 | Ga0160457_10027233 | 326 |
| 43 | 3300042598 | Ga0466701_007873 | Ga0466701_007873_45271_46251 | 326 |
| 44 | 3300042598 | Ga0466701_010917 | Ga0466701_010917_16038_17018 | 326 |
| 45 | 3300042598 | Ga0466701_070792 | Ga0466701_070792_19028_20008 | 326 |
| 46 | 3300042598 | Ga0466701_071843 | Ga0466701_071843_1576_2556 | 326 |
| 47 | 3300042615 | Ga0466711_294172 | Ga0466711_294172_3149_4129 | 326 |
| 48 | 3300042624 | Ga0466735_061864 | Ga0466735_061864_424_1404 | 326 |
| 49 | 3300042625 | Ga0466730_030722 | Ga0466730_030722_797501_798481 | 326 |
| 50 | 3300042636 | Ga0466703_057552 | Ga0466703_057552_731_1711 | 326 |
| 51 | 3300042649 | Ga0466724_12613 | Ga0466724_12613_923_1903 | 326 |
| 52 | 3300042649 | Ga0466724_18996 | Ga0466724_18996_33969_34949 | 326 |
| 53 | 3300042649 | Ga0466724_23916 | Ga0466724_23916_425441_426421 | 326 |
| 54 | 3300042649 | Ga0466724_34931 | Ga0466724_34931_1030_2010 | 326 |
| 55 | iso_pr_bacteria | 2785510743 | 2785736235 | 326 |
| 56 | iso_pr_bacteria | 2799112231 | 2799234186 | 326 |
| 57 | iso_pr_bacteria | 2811995047 | 2812946867 | 326 |
| 58 | iso_pr_bacteria | 2832298047 | 2832299454 | 326 |
| 59 | iso_pr_bacteria | 2832343623 | 2832345282 | 326 |
| 60 | iso_pr_bacteria | 2832372155 | 2832373594 | 326 |
| 61 | iso_pr_bacteria | 2838772460 | 2838773300 | 326 |
| 62 | iso_pr_bacteria | 2864878056 | 2864878125 | 326 |
| 63 | iso_pr_bacteria | 2864886855 | 2864888189 | 326 |
| 64 | iso_pr_bacteria | 2882250448 | 2882251729 | 326 |
| 65 | iso_pr_bacteria | 2896321640 | 2896324620 | 326 |
| 66 | iso_pr_bacteria | 2896330536 | 2896334185 | 326 |
| 67 | iso_pr_bacteria | 2896350215 | 2896353804 | 326 |
| 68 | iso_pr_bacteria | 2898741527 | 2898744918 | 326 |
| 69 | iso_pr_bacteria | 2899132286 | 2899135110 | 326 |
| 70 | iso_pr_bacteria | 2904728850 | 2904731361 | 326 |
| 71 | iso_pr_bacteria | 2958471994 | 2958474445 | 326 |
| 72 | 3300000333 | HBC_ctgsDRAFT_1000079 | HBC_ctgsDRAFT_10000797 | 327 |
| 73 | 3300007085 | Ga0104045_1003556 | Ga0104045_10035562 | 327 |
| 74 | 3300007085 | Ga0104045_1021785 | Ga0104045_10217853 | 327 |
| 75 | 3300007150 | Ga0104019_1003974 | Ga0104019_10039746 | 327 |
| 76 | 3300012824 | Ga0160469_100004 | Ga0160469_100004223 | 327 |
| 77 | 3300012848 | Ga0160443_100077 | Ga0160443_10007772 | 327 |
| 78 | 3300042596 | Ga0466696_022386 | Ga0466696_022386_2768_3751 | 327 |
| 79 | 3300042598 | Ga0466701_050423 | Ga0466701_050423_3691_4674 | 327 |
| 80 | 3300042598 | Ga0466701_082307 | Ga0466701_082307_49967_50950 | 327 |
| 81 | iso_pr_bacteria | 2590828803 | 2592929423 | 327 |
| 82 | iso_pr_bacteria | 2864822740 | 2864826125 | 327 |
| 83 | iso_pr_bacteria | 2864882932 | 2864886468 | 327 |
| 84 | iso_pr_bacteria | 2873776654 | 2873780200 | 327 |
| 85 | 3300005307 | Ga0074308_1114120 | Ga0074308_11141202 | 328 |
| 86 | 3300007085 | Ga0104045_1023322 | Ga0104045_10233223 | 328 |
| 87 | 3300007143 | Ga0104048_1001207 | Ga0104048_10012075 | 328 |
| 88 | 3300007143 | Ga0104048_1002999 | Ga0104048_10029997 | 328 |
| 89 | 3300007153 | Ga0104050_1200432 | Ga0104050_12004323 | 328 |
| 90 | 3300012803 | Ga0160465_100011 | Ga0160465_100011120 | 328 |
| 91 | 3300012825 | Ga0160441_100200 | Ga0160441_10020014 | 328 |
| 92 | 3300012835 | Ga0160446_100133 | Ga0160446_10013314 | 328 |
| 93 | 3300012839 | Ga0160472_100236 | Ga0160472_10023633 | 328 |
| 94 | 3300012839 | Ga0160472_104615 | Ga0160472_1046152 | 328 |
| 95 | 3300012857 | Ga0160435_1000049 | Ga0160435_100004958 | 328 |
| 96 | 3300042592 | Ga0466693_163279 | Ga0466693_163279_279_1265 | 328 |
| 97 | 3300042609 | Ga0466722_014489 | Ga0466722_014489_12279_13265 | 328 |
| 98 | 3300042610 | Ga0466698_445683 | Ga0466698_445683_94_1080 | 328 |
| 99 | 3300042619 | Ga0466726_093868 | Ga0466726_093868_18647_19633 | 328 |
| 100 | 3300042659 | Ga0466733_025467 | Ga0466733_025467_13409_14395 | 328 |
| 101 | iso_pr_bacteria | 2894649344 | 2894650276 | 328 |
| 102 | 3300000036 | IMNBGM34_c006410 | IMNBGM34_0064102 | 329 |
| 103 | 3300007153 | Ga0104050_1002152 | Ga0104050_100215213 | 329 |
| 104 | 3300009826 | Ga0123355_10521318 | Ga0123355_105213182 | 329 |
| 105 | 3300012813 | Ga0160470_100073 | Ga0160470_10007329 | 329 |
| 106 | 3300012815 | Ga0160440_103179 | Ga0160440_1031792 | 329 |
| 107 | 3300012829 | Ga0160467_100020 | Ga0160467_100020107 | 329 |
| 108 | 3300012846 | Ga0160433_100008 | Ga0160433_100008127 | 329 |
| 109 | 3300012847 | Ga0160445_109296 | Ga0160445_1092962 | 329 |
| 110 | 3300012858 | Ga0160457_1000732 | Ga0160457_10007324 | 329 |
| 111 | 3300042594 | Ga0466694_345345 | Ga0466694_345345_408_1397 | 329 |
| 112 | 3300042599 | Ga0466706_127960 | Ga0466706_127960_35193_36182 | 329 |
| 113 | 3300042602 | Ga0466713_081803 | Ga0466713_081803_2454_3443 | 329 |
| 114 | iso_pr_bacteria | 2864891731 | 2864893319 | 329 |
| 115 | 3300042625 | Ga0466730_097984 | Ga0466730_097984_399158_400150 | 330 |
| 116 | iso_pr_bacteria | 2687453786 | 2690170491 | 330 |
| 117 | iso_pr_bacteria | 2864831662 | 2864834265 | 330 |
| 118 | 3300007129 | Ga0102734_1001194 | Ga0102734_10011944 | 332 |
| 119 | 3300042621 | Ga0466729_075047 | Ga0466729_075047_3301_4302 | 333 |
| 120 | 3300042649 | Ga0466724_43696 | Ga0466724_43696_155539_156543 | 334 |
| 121 | iso_pr_bacteria | 2529292732 | 2529761238 | 334 |
| 122 | iso_pr_bacteria | 2847090942 | 2847093946 | 334 |
| 123 | iso_pr_bacteria | 2864788197 | 2864790538 | 334 |
| 124 | iso_pr_bacteria | 2864923010 | 2864925352 | 334 |
| 125 | iso_pr_bacteria | 2864948220 | 2864950560 | 334 |
| 126 | iso_pr_bacteria | 8020009074 | 8020012259 | 334 |
| 127 | iso_pr_bacteria | 8114076984 | 8114077576 | 334 |
| 128 | 3300002464 | Meta3P_1009319 | Meta3P_10093194 | 335 |
| 129 | 3300007068 | Ga0103265_1000011 | Ga0103265_100001131 | 338 |
| 130 | 3300007188 | Ga0103264_1000306 | Ga0103264_100030627 | 338 |
| 131 | 3300007068 | Ga0103265_1001581 | Ga0103265_10015812 | 339 |
| 132 | 3300007080 | Ga0102735_1000692 | Ga0102735_10006927 | 339 |
| 133 | 3300005307 | Ga0074308_1113768 | Ga0074308_11137684 | 340 |
| 134 | 3300007140 | Ga0102740_1000884 | Ga0102740_10008842 | 340 |
| 135 | 3300007153 | Ga0104050_1200857 | Ga0104050_12008573 | 340 |
| 136 | 3300012819 | Ga0160468_105377 | Ga0160468_1053772 | 340 |
| 137 | 3300042603 | Ga0466714_105890 | Ga0466714_105890_66_1091 | 341 |
| 138 | 3300042613 | Ga0466710_162661 | Ga0466710_162661_192_1220 | 342 |
| 139 | 3300002462 | JGI24702J35022_10008713 | JGI24702J35022_100087135 | 345 |
| 140 | iso_pr_bacteria | 2921902974 | 2921905062 | 347 |
| 141 | 3300042654 | Ga0466725_284756 | Ga0466725_284756_22190_23239 | 349 |
| 142 | 3300042582 | Ga0466657_072158 | Ga0466657_072158_712_1764 | 350 |
| 143 | 3300042598 | Ga0466701_022128 | Ga0466701_022128_1794_2885 | 363 |
| 144 | 3300012848 | Ga0160443_100054 | Ga0160443_100054142 | 364 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04443 | LuxE | Acyl-protein synthetase, LuxE | 44 | 361 | 0.79 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.