Protein Family IF03958

Metagenome Isolate
149 Members
110 Samples
94 Scaffolds
362.64 Avg Length

🧬 Representative Sequence

ID
3300012847|Ga0160445_106421|Ga0160445_1064212
Length
362 aa
Sequence
MSHNTFGHLFRVTTWGESHGPAIGCVVDGCPPLIPLTEADIQPWLDQRKPGGSRFVTQRQESDTARILSGVFDDGNGPVTTGTPISILIHNEDQRSRDYGEIARAFRPGHADYAYQAKYGVRDHRGGGRSSARETATRVAAGAIARRILGDAIRIRAGVVQIGPHRIAPDAVDFDAVGGNPLFAASSAVLPEWEAYLDGVRKAGSSIGAVVALEVTGVPAGWGAPLYGKLDAELAAALMSINAAKGVEIGAGFAAAELSGEANADEMRLDLNRQPVFLSNKAGGVLGGLSTGQPVTARVAFKPTSSILTPRQTITRDGEETDLRTKGRHDPCVALRAVPVVEAMAACVLADAMLRHRAQVG*

πŸ“Š Sample Types

Isolate 36.9%
Metagenome 63.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Apidae 20.2%
Unclassified 14.7%
Termitidae 13.8%
Kalotermitidae 11.0%
Formicidae 10.1%
Aphididae 9.2%
Elmidae 5.5%
Armadillidiidae 4.6%
Rhinotermitidae 2.8%
Culicidae 2.8%
Termopsidae 1.8%
Cerambycidae 0.9%
Hodotermitidae 0.9%
Crambidae 0.9%
Drosophilidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
2 2834415282 Snodgrassella alvi Occ4-2 Isolate Apidae
3 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
4 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
5 2868464004 Snodgrassella alvi Pens2-2-5 Isolate Apidae
6 2884498641 Buchnera aphidicola BuCicurvipes/3402 Isolate Aphididae
7 2884500114 Buchnera aphidicola BuCicuneomaculata/2628 Isolate Aphididae
8 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
9 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
10 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2585427850 Snodgrassella alvi wkB12 Isolate Apidae
15 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
16 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
17 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
18 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
19 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
20 2846861257 Buchnera aphidicola LSU Isolate Aphididae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300009478 Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov Metagenome
23 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
24 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
34 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
35 2846376288 Snodgrassella alvi Fer4-2 Isolate Apidae
36 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
37 2849399727 Snodgrassella alvi Fer1-2 Isolate Apidae
38 2857837414 Snodgrassella alvi App4-8 Isolate Apidae
39 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
40 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
41 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
44 2603880165 Burkholderiales A1 Isolate Unclassified
45 2603880172 Burkholderiales C Isolate Unclassified
46 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2511231158 Buchnera aphidicola Ua Isolate Aphididae
53 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
54 2857827427 Snodgrassella alvi App6-4 Isolate Apidae
55 2857832487 Snodgrassella alvi HK9x Isolate Apidae
56 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
57 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
58 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
59 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
60 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
61 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
64 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
65 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
66 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
67 2585427851 Snodgrassella alvi wkB29 Isolate Apidae
68 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
69 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
70 2843639003 Buchnera aphidicola BuCistrobi/3249 Isolate Aphididae
71 2846373876 Snodgrassella alvi Gris1-3 Isolate Apidae
72 2848751009 Snodgrassella alvi App2-2 Isolate Apidae
73 2854084220 Snodgrassella alvi Snod2-1-5 Isolate Apidae
74 2854102457 Snodgrassella alvi Gris1-6 Isolate Apidae
75 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
76 2857845033 Snodgrassella alvi WF3-3 Isolate Apidae
77 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
78 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
79 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
80 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
81 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
82 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
83 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
84 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
85 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
86 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
87 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
88 2837560943 Snodgrassella alvi HK3 Isolate Apidae
89 2846366200 Snodgrassella alvi Gris3-4 Isolate Apidae
90 2857842411 Snodgrassella alvi Ruf1-X Isolate Apidae
91 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
92 2884492481 Buchnera aphidicola BuCicurtihirsuta/3053 Isolate Aphididae
93 2884492905 Buchnera aphidicola BuCipiceae/3303 Isolate Aphididae
94 2884500535 Buchnera aphidicola BuCilaricifoliae/3058 Isolate Aphididae
95 3006156446 Acinetobacter baretiae B10A Isolate Apidae
96 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
97 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
98 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
99 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
100 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
101 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
102 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
103 2854104879 Snodgrassella alvi Fer2-2 Isolate Apidae
104 2868461634 Snodgrassella alvi Gris2-3-4 Isolate Apidae
105 2884499693 Buchnera aphidicola BuCikochiana/2762 Isolate Aphididae
106 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
107 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
108 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
109 639633012 Buchnera aphidicola Bp Isolate Aphididae
110 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_103526 3300042623 Unclassified 87559
2 Ga0466704_468127 3300042643 Bacteria 3818
3 Ga0123355_10037798 3300009826 Bacteria 7851
4 Ga0123356_10020901 3300010049 Bacteria 6191
5 Ga0123356_10233286 3300010049 Bacteria 1906
6 Ga0123354_10000029 3300010882 Bacteria 108162
7 Ga0466722_059528 3300042609 Bacteria 3737
8 JGI24702J35022_10010036 3300002462 Bacteria 5304
9 CVPL005W_1000177 3300002934 Bacteria 50770
10 CVPL005W_1000481 3300002934 Bacteria 34713
11 Ga0103263_103019 3300007042 Unclassified 2039
12 Ga0102738_1002132 3300007141 Unclassified 2979
13 Ga0127524_100015 3300009478 Bacteria 633867
14 Ga0466697_173538 3300042611 Bacteria 4400
15 Ga0466708_440413 3300042652 Bacteria 8144
16 Ga0466691_142634 3300042593 Bacteria 8807
17 Ga0466710_269365 3300042613 Bacteria 7173
18 Ga0466726_067098 3300042619 Bacteria 3678
19 Ga0466706_152882 3300042599 Bacteria 22861
20 Ga0466719_047024 3300042606 Bacteria 3887
21 Ga0102739_1000385 3300007095 Bacteria 9528
22 Ga0102740_1003323 3300007140 Bacteria 3476
23 Ga0103264_1000078 3300007188 Bacteria 147291
24 Ga0123357_10000046 3300009784 Bacteria 99884
25 Ga0466709_039602 3300042648 Bacteria 7660
26 Ga0466725_150948 3300042654 Bacteria 53167
27 Ga0466725_321878 3300042654 Bacteria 1838
28 Ga0160435_1000083 3300012857 Bacteria 57275
29 Ga0123355_10639667 3300009826 Unclassified 1246
30 CVPL010W_10004041 3300002931 Bacteria 24346
31 Ga0103265_1001992 3300007068 Bacteria 3201
32 Ga0466704_241482 3300042643 Bacteria 2091
33 Ga0466704_561171 3300042643 Bacteria 3166
34 Ga0466724_60940 3300042649 Bacteria 1474
35 Ga0466727_011744 3300042655 Bacteria 6729
36 Ga0160470_100181 3300012813 Bacteria 56412
37 Ga0123356_10016007 3300010049 Bacteria 7169
38 Ga0466711_126392 3300042615 Bacteria 29897
39 Ga0466723_263911 3300042618 Bacteria 9226
40 Ga0466726_124955 3300042619 Bacteria 2722
41 Ga0466726_225836 3300042619 Bacteria 1930
42 Ga0466706_065220 3300042599 Bacteria 13272
43 Ga0102736_1000487 3300007052 Bacteria 8287
44 Ga0466725_047312 3300042654 Bacteria 3005
45 Ga0160445_106421 3300012847 Bacteria 1921
46 Ga0160436_1000155 3300012861 Bacteria 34463
47 Ga0123354_10006388 3300010882 Bacteria 17495
48 Ga0466710_161518 3300042613 Bacteria 1670
49 Ga0466715_310150 3300042616 Bacteria 13977
50 Ga0466701_068613 3300042598 Bacteria 30748
51 Ga0102738_1000133 3300007141 Bacteria 21430
52 Ga0103264_1001357 3300007188 Bacteria 14992
53 Ga0466708_190700 3300042652 Bacteria 29705
54 Ga0160433_100010 3300012846 Bacteria 293456
55 Ga0160443_100007 3300012848 Bacteria 631542
56 Ga0466657_015947 3300042582 Bacteria 203876
57 Ga0466657_354690 3300042582 Bacteria 3382
58 Ga0466657_390823 3300042582 Bacteria 58911
59 Ga0466693_317855 3300042592 Bacteria 6673
60 Ga0466701_030460 3300042598 Bacteria 6990
61 Ga0103260_1000747 3300007139 Bacteria 6080
62 Ga0102740_1000280 3300007140 Bacteria 31708
63 Ga0102737_1000007 3300007142 Bacteria 71987
64 Ga0102737_1000234 3300007142 Bacteria 18842
65 Ga0103264_1000067 3300007188 Bacteria 62974
66 Ga0466708_154825 3300042652 Bacteria 3430
67 Ga0466708_204477 3300042652 Bacteria 15636
68 Ga0466708_352635 3300042652 Bacteria 2697
69 Ga0466725_037252 3300042654 Bacteria 45444
70 Ga0466725_421746 3300042654 Bacteria 2260
71 Ga0466692_033632 3300042591 Bacteria 31831
72 Ga0466695_343973 3300042595 Bacteria 2247
73 Ga0123355_10220229 3300009826 Bacteria 2731
74 Ga0123353_10013509 3300010167 Bacteria 11702
75 Ga0466710_381390 3300042613 Bacteria 32855
76 Ga0466707_165317 3300042601 Bacteria 1720
77 Ga0466716_278362 3300042605 Bacteria 14360
78 Ga0104044_1146450 3300007136 Bacteria 2678
79 Ga0466729_243623 3300042621 Bacteria 3875
80 Ga0466734_028347 3300042623 Bacteria 4607
81 Ga0466734_066765 3300042623 Bacteria 8550
82 Ga0466703_202420 3300042636 Bacteria 8876
83 Ga0466725_122565 3300042654 Bacteria 38170
84 Ga0466725_205497 3300042654 Bacteria 2957
85 Ga0160469_100118 3300012824 Bacteria 111072
86 Ga0160435_1000002 3300012857 Bacteria 505104
87 Ga0160457_1002174 3300012858 Unclassified 4339
88 Ga0466657_082505 3300042582 Bacteria 18827
89 Ga0466690_065424 3300042590 Bacteria 36052
90 Ga0466691_180576 3300042593 Bacteria 6487
91 Ga0466710_114442 3300042613 Bacteria 6906
92 Ga0466710_375719 3300042613 Bacteria 1539
93 Ga0466728_340533 3300042620 Bacteria 3447
94 CVPL010W_10017485 3300002931 Bacteria 5840

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01264 Chorismate_synt Chorismate synthase 10 354 0.94

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.