Protein Family IF03914

Metagenome Isolate
171 Members
142 Samples
73 Scaffolds
531.43 Avg Length

🧬 Representative Sequence

ID
3300012846|Ga0160433_100217|Ga0160433_10021719
Length
583 aa
Sequence
MRGTAQWLMFDAGGANAYAAMTRSILELFAQRPGWPRIAFALAWETGVQVKPSFGMNDQGITTAADVKWNLLTAPLVEEAVRNGEGVLAKDGPLVVETGKHTGRSAKDKFIVRDATTEETISWGDVNVPMTPERFAALKADFFAALGEKKQLYVADLFGGSQAEHRVNVRVINEFAWHNLFIRTLLVRPERDTLAGFTPEYTIIDLPSFRADPARHGSRSETIIAVNFTEKLILIGGTAYAGEMKKSVFSILNYLLPAKGIMPMHCSANIGPDGDTAVFFGLSGTGKTTLSADASRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSAEAEPEIFATTKRFGTVLENVVIDPETREIDLDDATLAENSRGSYPIDFIPNASEDNLGPVPKNIIFLTADAYGVLPPIARLTPDQAMYHFLSGYTARVAGTEIGVTEPQATFSTCFGAPFMPRRPSVYGNLLKERIAKGGVKCWLVNTGWTGGKATDPGISRMPIKVTRALLNAALDGSLNNAEFRVDPNFGFEVPVAVGDIDPNMLDPRAAWSDKARYDETAADLLGKFVANFTQFEGDVDASVRDVLKAPVAA*

📊 Sample Types

Isolate 57.3%
Metagenome 42.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 16.4%
Apidae 13.4%
Termitidae 11.9%
Drosophilidae 11.9%
Elmidae 7.5%
Kalotermitidae 5.2%
Formicidae 5.2%
Pyralidae 4.5%
Culicidae 4.5%
Armadillidiidae 3.0%
Nephropidae 2.2%
Scarabaeidae 2.2%
Bombycidae 2.2%
Calliphoridae 0.7%
Tenebrionidae 0.7%
Hodotermitidae 0.7%
Passalidae 0.7%
Curculionidae 0.7%
Noctuidae 0.7%
Eresidae 0.7%
Rhinotermitidae 0.7%
Daphniidae 0.7%
Ocypodidae 0.7%
Portunidae 0.7%
Muscidae 0.7%
Euphausiidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
2 2590828839 Clostridium sp. 1 Isolate Termitidae
3 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
4 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
5 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
6 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
7 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
8 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
9 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
10 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
11 2882250448 Bizionia sp. APA-3 Isolate
12 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
16 8068946563 Bartonella apihabitans M0187 Isolate Apidae
17 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
18 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
19 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
20 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
26 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
27 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
28 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
29 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
30 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
31 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
32 8073626464 Bartonella apis W8152 Isolate Apidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
38 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
39 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
40 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
41 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
42 2864895409 Bacillus aerius S00152 Isolate Elmidae
43 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
44 2896321640 Sphingobacterium sp. xlx-130 Isolate
45 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
46 8022725327 Bacillus sp. SN10 Isolate Eresidae
47 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
48 8068953321 Bartonella apihabitans M0190 Isolate Apidae
49 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
50 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
51 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
52 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
53 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
54 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
55 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
56 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
60 2751185856 Bartonella apis BBC0244 Isolate Apidae
61 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
62 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
63 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
64 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
65 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
66 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
67 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
68 2864909992 Bacillus velezensis S00166 Isolate Elmidae
69 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
70 2898741527 Sphingobacterium sp. xlx-73 Isolate
71 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
72 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
73 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
74 8073617375 Bartonella apis W8098 Isolate Apidae
75 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
76 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
77 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
78 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
79 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
80 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
81 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
82 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
83 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
84 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
85 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
86 8073624232 Bartonella sp. W8151 Isolate Apidae
87 2978778678 Bacillus cereus 25 Isolate Ocypodidae
88 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
89 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
90 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
91 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
92 2751185853 Bartonella apis BBC0178 Isolate Apidae
93 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
94 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
95 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
96 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
97 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
98 2896330536 Sphingobacterium sp. xlx-96 Isolate
99 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
100 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
101 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
102 8068944069 Bartonella choladocola W8125 Isolate Apidae
103 8068955631 Bartonella apihabitans M0280 Isolate Apidae
104 8073628750 Bartonella sp. W8167 Isolate Apidae
105 2969145278 Bacillus cereus 29 Isolate Portunidae
106 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
107 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
108 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
109 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
110 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
111 2593339125 Clostridium sp. 5 Isolate Termitidae
112 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
113 2718218026 Phaeobacter porticola P97 Isolate Unclassified
114 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
115 2841330038 Sulfitobacter sp. D7 Isolate
116 2864801025 Bacillus aerius S00042 Isolate Elmidae
117 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
118 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
119 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
120 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
121 8068950955 Bartonella apihabitans W8097 Isolate Apidae
122 8073621894 Bartonella apis W8099 Isolate Apidae
123 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
124 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
125 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
126 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
127 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
128 2537562000 Bacillus cereus HD73 Isolate Pyralidae
129 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
130 2695420964 Hyphomicrobiales bacterium JR021 Isolate Unclassified
131 2751185858 Bartonella apis BBC0122 Isolate Apidae
132 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
133 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
134 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
135 2896350215 Sphingobacterium sp. xlx-183 Isolate
136 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
137 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
138 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
139 8073619611 Bartonella apis B10834G6 Isolate Apidae
140 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
141 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
142 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466708_081554 3300042652 Bacteria 30455
2 Ga0160446_100009 3300012835 Bacteria 341409
3 Ga0160460_100108 3300012845 Bacteria 114707
4 CVPL010L_1000004 3300002932 Bacteria 122747
5 Ga0072940_1056999 3300005200 Bacteria 2010
6 Ga0102738_1000042 3300007141 Bacteria 59015
7 Ga0103267_1000045 3300007190 Bacteria 74090
8 Ga0123353_10108030 3300010167 Unclassified 4484
9 Ga0530661_000915 3300056564 Bacteria 17839
10 Ga0160456_100001 3300012820 Bacteria 1115787
11 Ga0466657_042903 3300042582 Bacteria 1750
12 Ga0466657_109529 3300042582 Bacteria 25557
13 Ga0063521_1000525 3300003973 Bacteria 17214
14 Ga0104019_1005060 3300007150 Bacteria 5244
15 Ga0123356_10106922 3300010049 Bacteria 2695
16 Ga0123353_10001502 3300010167 Bacteria 28580
17 Ga0466733_131886 3300042659 Bacteria 6248
18 Ga0466707_174018 3300042601 Bacteria 2603
19 Ga0466717_078841 3300042604 Bacteria 4088
20 Ga0466721_090289 3300042608 Bacteria 2738
21 Ga0160460_100148 3300012845 Bacteria 80857
22 Ga0466696_023405 3300042596 Bacteria 42390
23 Ga0104048_1168451 3300007143 Unclassified 6325
24 Ga0104050_1026123 3300007153 Unclassified 7466
25 Ga0123356_10009260 3300010049 Bacteria 9728
26 Ga0123356_10016485 3300010049 Bacteria 7047
27 Ga0466724_44792 3300042649 Bacteria 6543
28 Ga0466707_040784 3300042601 Bacteria 59863
29 Ga0466696_220610 3300042596 Bacteria 9161
30 JGI24702J35022_10026865 3300002462 Bacteria 3098
31 Ga0074278_154579 3300005721 Bacteria 6884
32 Ga0104050_1001682 3300007153 Bacteria 13586
33 Ga0466715_127167 3300042616 Bacteria 83910
34 Ga0466734_127287 3300042623 Bacteria 12928
35 Ga0160446_100071 3300012835 Bacteria 101245
36 Ga0160457_1000010 3300012858 Bacteria 500717
37 Ga0466657_150244 3300042582 Bacteria 14090
38 2211830555 2209111004 Bacteria 21478
39 CVPL010W_10006870 3300002931 Bacteria 11457
40 CVPL005W_1000248 3300002934 Bacteria 23457
41 Ga0123356_10017757 3300010049 Bacteria 6760
42 Ga0466730_056090 3300042625 Bacteria 2576
43 Ga0466730_079418 3300042625 Bacteria 679131
44 Ga0466704_325088 3300042643 Unclassified 38417
45 Ga0466724_47083 3300042649 Bacteria 378486
46 Ga0466724_64213 3300042649 Bacteria 1880
47 Ga0466706_131958 3300042599 Bacteria 3176
48 Ga0466706_134026 3300042599 Bacteria 5941
49 Ga0104048_1002243 3300007143 Bacteria 9321
50 Ga0123357_10000834 3300009784 Bacteria 31276
51 Ga0123357_10000965 3300009784 Bacteria 29254
52 Ga0123356_10011157 3300010049 Unclassified 8772
53 Ga0466711_139054 3300042615 Bacteria 24266
54 Ga0466715_171580 3300042616 Bacteria 16482
55 Ga0466717_187766 3300042604 Unclassified 3611
56 Ga0466722_253258 3300042609 Bacteria 6136
57 Ga0160459_102021 3300012831 Bacteria 3600
58 Ga0160433_100217 3300012846 Bacteria 43589
59 Ga0466657_008626 3300042582 Bacteria 77234
60 IMNBL1DRAFT_c0000113 3300000062 Bacteria 72819
61 JGI24705J35276_12236157 3300002504 Bacteria 7576
62 Ga0063521_1000290 3300003973 Unclassified 30884
63 Ga0103267_1000192 3300007190 Bacteria 56966
64 Ga0127649_104927 3300009460 Bacteria 36792
65 Ga0123353_10000890 3300010167 Bacteria 36477
66 Ga0466715_317474 3300042616 Bacteria 28415
67 Ga0466719_290641 3300042606 Bacteria 8152
68 Ga0160455_101366 3300012837 Bacteria 7567
69 Ga0160472_101396 3300012839 Unclassified 7210
70 Ga0160447_100011 3300012849 Bacteria 463863
71 Ga0104045_1005066 3300007085 Unclassified 6149
72 Ga0104050_1030692 3300007153 Unclassified 2287
73 Ga0123356_10031525 3300010049 Bacteria 4960

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005721 Ga0074278_154579 Ga0074278_1545798 426
2 3300007153 Ga0104050_1030692 Ga0104050_10306924 439
3 iso_pr_bacteria 2820127165 2820129571 506
4 3300042609 Ga0466722_253258 Ga0466722_253258_4420_5952 510
5 iso_pr_bacteria 2989309576 2989312214 511
6 3300042604 Ga0466717_187766 Ga0466717_187766_54_1592 512
7 iso_pr_bacteria 2820451402 2820452694 516
8 3300010167 Ga0123353_10108030 Ga0123353_101080302 517
9 iso_pr_bacteria 2636416028 2638991656 519
10 3300042625 Ga0466730_056090 Ga0466730_056090_136_1704 522
11 iso_pr_bacteria 2820142992 2820145915 522
12 3300042599 Ga0466706_131958 Ga0466706_131958_376_1947 523
13 3300042601 Ga0466707_040784 Ga0466707_040784_37060_38631 523
14 3300042616 Ga0466715_171580 Ga0466715_171580_5330_6901 523
15 3300042649 Ga0466724_64213 Ga0466724_64213_233_1804 523
16 3300010049 Ga0123356_10106922 Ga0123356_101069222 524
17 3300000062 IMNBL1DRAFT_c0000113 IMNBL1DRAFT_000011322 525
18 3300002462 JGI24702J35022_10026865 JGI24702J35022_100268652 525
19 3300042601 Ga0466707_174018 Ga0466707_174018_667_2244 525
20 iso_pr_bacteria 2852431164 2852434554 525
21 iso_pr_bacteria 643886090 644663699 525
22 3300042596 Ga0466696_220610 Ga0466696_220610_2199_3779 526
23 3300042604 Ga0466717_078841 Ga0466717_078841_823_2403 526
24 3300042606 Ga0466719_290641 Ga0466719_290641_1054_2634 526
25 3300042616 Ga0466715_127167 Ga0466715_127167_25798_27378 526
26 3300042643 Ga0466704_325088 Ga0466704_325088_36655_38235 526
27 iso_pr_bacteria 2590828839 2593253830 526
28 iso_pr_bacteria 2593339125 2595066369 526
29 iso_pr_bacteria 2820441105 2820441304 526
30 iso_pr_bacteria 2827179085 2827182887 526
31 iso_pr_bacteria 2854540230 2854542850 526
32 iso_pr_bacteria 651324002 651579036 526
33 2209111004 2211830555 2211865764 527
34 3300010167 Ga0123353_10000890 Ga0123353_1000089010 527
35 3300042596 Ga0466696_023405 Ga0466696_023405_28541_30124 527
36 3300042615 Ga0466711_139054 Ga0466711_139054_17336_18919 527
37 iso_pr_bacteria 2574180310 2576358072 527
38 iso_pr_bacteria 2767802234 2769331782 527
39 iso_pr_bacteria 2791355481 2794425085 527
40 iso_pr_bacteria 2864891731 2864894193 527
41 iso_pr_bacteria 2864909992 2864913128 527
42 3300042652 Ga0466708_081554 Ga0466708_081554_276_1862 528
43 iso_pr_bacteria 2524614537 2524835589 528
44 iso_pr_bacteria 2537562000 2539433742 528
45 iso_pr_bacteria 2563367190 2565787472 528
46 iso_pr_bacteria 2590828839 2593250562 528
47 iso_pr_bacteria 2751185832 2753511581 528
48 iso_pr_bacteria 2822232166 2822236494 528
49 iso_pr_bacteria 2822450720 2822452073 528
50 iso_pr_bacteria 2843246524 2843247760 528
51 iso_pr_bacteria 2852123468 2852126060 528
52 iso_pr_bacteria 2855361764 2855363932 528
53 iso_pr_bacteria 2864782175 2864783679 528
54 iso_pr_bacteria 2864801025 2864803130 528
55 iso_pr_bacteria 2864895409 2864897512 528
56 iso_pr_bacteria 2864981449 2864984870 528
57 iso_pr_bacteria 2890957088 2890960654 528
58 iso_pr_bacteria 2912849059 2912853972 528
59 iso_pr_bacteria 2916873227 2916879122 528
60 iso_pr_bacteria 2969145278 2969150017 528
61 iso_pr_bacteria 2978778678 2978782327 528
62 iso_pr_bacteria 643886085 644682144 528
63 iso_pr_bacteria 643886087 644669769 528
64 iso_pr_bacteria 643886091 644650833 528
65 iso_pr_bacteria 8022725327 8022727355 528
66 iso_pr_bacteria 8022781829 8022784581 528
67 iso_pr_bacteria 8043041867 8043041907 528
68 iso_pr_bacteria 8061039349 8061044489 528
69 iso_pr_bacteria 8061045771 8061046790 528
70 iso_pr_bacteria 8061100935 8061102477 528
71 3300003973 Ga0063521_1000290 Ga0063521_100029013 529
72 3300042582 Ga0466657_042903 Ga0466657_042903_73_1662 529
73 iso_pr_bacteria 8002519755 8002521163 529
74 3300042659 Ga0466733_131886 Ga0466733_131886_2245_3837 530
75 3300042616 Ga0466715_317474 Ga0466715_317474_26510_28105 531
76 iso_pr_bacteria 2751185853 2753587853 531
77 iso_pr_bacteria 2751185856 2753593205 531
78 iso_pr_bacteria 2751185858 2753597168 531
79 iso_pr_bacteria 2839785767 2839788261 531
80 iso_pr_bacteria 8068941587 8068942287 531
81 iso_pr_bacteria 8068944069 8068944507 531
82 iso_pr_bacteria 8068946563 8068947903 531
83 iso_pr_bacteria 8068950955 8068951765 531
84 iso_pr_bacteria 8068953321 8068955071 531
85 iso_pr_bacteria 8068955631 8068957355 531
86 iso_pr_bacteria 8073617375 8073617609 531
87 iso_pr_bacteria 8073619611 8073620036 531
88 iso_pr_bacteria 8073621894 8073622673 531
89 iso_pr_bacteria 8073624232 8073624666 531
90 iso_pr_bacteria 8073626464 8073628331 531
91 iso_pr_bacteria 8073628750 8073630579 531
92 iso_pr_bacteria 8082291289 8082293880 531
93 3300002931 CVPL010W_10006870 CVPL010W_100068701 532
94 3300012835 Ga0160446_100009 Ga0160446_10000989 532
95 3300012839 Ga0160472_101396 Ga0160472_1013967 532
96 3300012849 Ga0160447_100011 Ga0160447_10001190 532
97 3300042582 Ga0466657_109529 Ga0466657_109529_770_2368 532
98 iso_pr_bacteria 2711768164 2712503505 532
99 iso_pr_bacteria 2718218026 2719799932 532
100 iso_pr_bacteria 2806310572 2806766656 532
101 iso_pr_bacteria 2816332503 2818123830 532
102 iso_pr_bacteria 2816332545 2818334989 532
103 iso_pr_bacteria 2835143510 2835146363 532
104 iso_pr_bacteria 2841330038 2841333122 532
105 3300012835 Ga0160446_100071 Ga0160446_10007162 533
106 3300012845 Ga0160460_100108 Ga0160460_10010837 533
107 3300042625 Ga0466730_079418 Ga0466730_079418_442187_443788 533
108 iso_pr_bacteria 2811995047 2812946703 533
109 iso_pr_bacteria 2820115951 2820118090 533
110 iso_pr_bacteria 2820115951 2820118241 533
111 iso_pr_bacteria 2864976888 2864979240 533
112 3300009784 Ga0123357_10000834 Ga0123357_1000083414 534
113 iso_pr_bacteria 2864878056 2864878906 534
114 iso_pr_bacteria 2864886855 2864887406 534
115 iso_pr_bacteria 2882250448 2882252509 534
116 3300007141 Ga0102738_1000042 Ga0102738_100004217 535
117 3300007143 Ga0104048_1168451 Ga0104048_11684512 535
118 3300007150 Ga0104019_1005060 Ga0104019_10050601 535
119 3300007153 Ga0104050_1026123 Ga0104050_10261233 535
120 3300012845 Ga0160460_100148 Ga0160460_10014823 535
121 3300012858 Ga0160457_1000010 Ga0160457_1000010427 535
122 3300042599 Ga0466706_134026 Ga0466706_134026_2399_4006 535
123 iso_pr_bacteria 2828301124 2828302530 535
124 iso_pr_bacteria 2886876212 2886876331 535
125 3300002934 CVPL005W_1000248 CVPL005W_100024818 536
126 3300010167 Ga0123353_10001502 Ga0123353_1000150210 536
127 3300042582 Ga0466657_150244 Ga0466657_150244_8892_10502 536
128 3300042623 Ga0466734_127287 Ga0466734_127287_8174_9784 536
129 3300042649 Ga0466724_47083 Ga0466724_47083_139469_141079 536
130 iso_pr_bacteria 8067483258 8067485452 536
131 3300003973 Ga0063521_1000525 Ga0063521_10005254 537
132 3300009460 Ga0127649_104927 Ga0127649_10492730 537
133 3300012831 Ga0160459_102021 Ga0160459_1020212 537
134 3300012837 Ga0160455_101366 Ga0160455_1013662 537
135 iso_pr_bacteria 2864955722 2864957888 537
136 iso_pr_bacteria 2896321640 2896323852 537
137 iso_pr_bacteria 2896330536 2896332421 537
138 iso_pr_bacteria 2896350215 2896352233 537
139 iso_pr_bacteria 2898741527 2898744365 537
140 3300002504 JGI24705J35276_12236157 JGI24705J35276_122361574 538
141 3300007085 Ga0104045_1005066 Ga0104045_10050664 538
142 3300007143 Ga0104048_1002243 Ga0104048_10022432 538
143 3300007153 Ga0104050_1001682 Ga0104050_10016828 538
144 3300007190 Ga0103267_1000045 Ga0103267_10000459 538
145 3300007190 Ga0103267_1000192 Ga0103267_100019216 538
146 3300010049 Ga0123356_10031525 Ga0123356_100315253 538
147 3300042582 Ga0466657_008626 Ga0466657_008626_45483_47102 539
148 iso_pr_bacteria 2858102877 2858104144 539
149 iso_pr_bacteria 2858129007 2858129420 539
150 iso_pr_bacteria 2868677537 2868680195 539
151 3300010049 Ga0123356_10009260 Ga0123356_100092602 540
152 3300042649 Ga0466724_44792 Ga0466724_44792_3090_4712 540
153 iso_pr_bacteria 2579779088 2582239373 540
154 iso_pr_bacteria 8116947750 8116947883 540
155 3300042608 Ga0466721_090289 Ga0466721_090289_883_2508 541
156 3300056564 Ga0530661_000915 Ga0530661_000915_8266_9894 542
157 iso_pr_bacteria 2868683769 2868685059 542
158 iso_pr_bacteria 2695420964 2698253057 543
159 3300002932 CVPL010L_1000004 CVPL010L_100000420 544
160 iso_pr_bacteria 2816332478 2818030703 544
161 iso_pr_bacteria 2834852038 2834852746 544
162 iso_pr_bacteria 2858089842 2858092319 544
163 iso_pr_bacteria 2854518031 2854519418 545
164 iso_pr_bacteria 2858110640 2858111223 545
165 3300009784 Ga0123357_10000965 Ga0123357_1000096524 550
166 3300010049 Ga0123356_10016485 Ga0123356_100164854 552
167 3300012820 Ga0160456_100001 Ga0160456_1000011054 556
168 3300010049 Ga0123356_10011157 Ga0123356_100111574 581
169 3300010049 Ga0123356_10017757 Ga0123356_100177575 581
170 3300005200 Ga0072940_1056999 Ga0072940_10569991 583
171 3300012846 Ga0160433_100217 Ga0160433_10021719 583

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01293 PEPCK_ATP Phosphoenolpyruvate carboxykinase 66 530 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.