Protein Family IF03913

Metagenome Isolate
343 Members
264 Samples
116 Scaffolds
198.81 Avg Length

🧬 Representative Sequence

ID
3300012846|Ga0160433_100200|Ga0160433_10020030
Length
224 aa
Sequence
MQQMPKVGMQPIRRQQLIEATLLAVDQVGLGDASIALIARLAGVSNGIISHYFQDKNGLIAATMRYIMSMLNEGVVARRQALSDDSPRAHLKVIIEGNFDASQVNGPAMKTWLAFWASSMHQPSLHRLQRINDHRLYSNLCCQFRRVLPIAEARTAARGLAALIDGLWLRGALSGDAFDTEQAIRIAYEYMELQLAKQRPDTELQASEPPRSAIVRQTGARRG*

📊 Sample Types

Isolate 66.2%
Metagenome 33.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 27.8%
Unclassified 9.0%
Drosophilidae 8.2%
Anthocoridae 7.8%
Formicidae 7.8%
Curculionidae 7.1%
Muscidae 5.1%
Culicidae 4.7%
Elmidae 3.9%
Calliphoridae 3.5%
Termitidae 2.4%
Apidae 2.0%
Tenebrionidae 2.0%
Tephritidae 1.2%
Pentatomidae 0.8%
Berytidae 0.8%
Sarcophagidae 0.8%
Armadillidiidae 0.8%
Cerambycidae 0.4%
Carabidae 0.4%
Kalotermitidae 0.4%
Siricidae 0.4%
Crambidae 0.4%
Alydidae 0.4%
Largidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Pediculidae 0.4%
Pteromalidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 304
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
3 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
4 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
5 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
6 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
7 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
8 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
9 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
10 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
11 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
12 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
13 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
14 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
15 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
16 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
17 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
18 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
19 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
20 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
21 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
22 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
23 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
24 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
25 8052469819 Pseudomonas putida DZ-F23 Isolate
26 8071343737 Escherichia coli PN119 Isolate Calliphoridae
27 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
28 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
29 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
30 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
31 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
32 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
33 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
34 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
35 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
36 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
37 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
38 2703719240 Serratia marcescens ano2 Isolate Unclassified
39 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
40 2871771314 Pantoea sp. Ae16 Isolate Culicidae
41 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
42 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
43 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
44 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
45 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
46 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
47 3006156446 Acinetobacter baretiae B10A Isolate Apidae
48 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
49 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
50 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
51 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
52 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
53 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
54 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
55 648276708 Pantoea sp. aB Isolate Unclassified
56 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
57 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
58 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
59 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
60 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
61 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
62 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
63 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
64 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
65 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
66 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
67 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
68 8102102351 Caballeronia sp. INML1 Isolate Coreidae
69 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
70 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
71 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
72 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
73 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
74 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
75 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
76 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
77 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
78 2937735258 Serratia marcescens KZ11 Isolate Apidae
79 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
80 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
81 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
82 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
83 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
84 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
85 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
86 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
87 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
88 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
89 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
90 8023757577 Caballeronia peredens LP006 Isolate Coreidae
91 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
92 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
93 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
94 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
95 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
96 8100181737 Kosakonia sp. S58 Isolate Curculionidae
97 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
98 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
99 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
100 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
101 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
102 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
103 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
104 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
105 2703719239 Serratia marcescens ano1 Isolate Unclassified
106 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
107 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
108 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
109 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
110 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
111 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
112 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
113 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
114 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
115 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
116 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
117 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
118 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
119 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
120 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
121 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
122 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
123 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
124 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
125 8004541719 Serratia marcescens KZ19 Isolate Apidae
126 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
127 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
128 8035422605 Pseudomonas monteilii CY06 Isolate
129 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
130 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
131 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
132 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
133 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
134 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
135 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
136 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
137 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
138 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
139 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
140 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
141 2971189173 Yersinia pestis A-1249 Isolate Unclassified
142 2972038244 Pseudomonas sp. DS1 Isolate Formicidae
143 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
144 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
145 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
146 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
147 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
148 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
149 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
150 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
151 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
152 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
153 637000219 Pseudomonas entomophila L48 Isolate Unclassified
154 8021546568 Klebsiella sp. Kps Isolate Tephritidae
155 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
156 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
157 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
158 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
159 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
160 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
161 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
162 8071322446 Escherichia coli PN122 Isolate Calliphoridae
163 8100171289 Kosakonia sp. S42 Isolate Curculionidae
164 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
165 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
166 8102124461 Caballeronia sp. INML3B Isolate Coreidae
167 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
168 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
169 8103002986 Erwinia sp. S38 Isolate Curculionidae
170 8103008710 Erwinia sp. S43 Isolate Curculionidae
171 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
172 2718217944 Serratia marcescens AS1 Isolate Culicidae
173 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
174 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
175 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
176 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
177 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
178 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
179 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
180 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
181 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
182 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
183 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
184 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
185 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
186 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
187 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
188 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
189 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
190 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
191 8100176769 Kosakonia sp. S57 Isolate Curculionidae
192 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
193 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
194 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
195 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
196 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
197 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
198 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
199 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
200 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
201 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
202 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
203 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
204 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
205 2603880173 Pseudomonas SP. Isolate Unclassified
206 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
207 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
208 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
209 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
210 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
211 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
212 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
213 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
214 2958255616 Serratia marcescens TM Isolate
215 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
216 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
217 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
218 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
219 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
220 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
221 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
222 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
223 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
224 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
225 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
226 8071333649 Escherichia coli PN108 Isolate Calliphoridae
227 8071338694 Escherichia coli PN87 Isolate Calliphoridae
228 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
229 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
230 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
231 8102117041 Caballeronia sp. INML3 Isolate Coreidae
232 8102131453 Caballeronia sp. INML5 Isolate Coreidae
233 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
234 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
235 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
236 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
237 8102982778 Erwinia sp. S63 Isolate Curculionidae
238 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
239 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
240 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
241 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
242 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
243 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
244 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
245 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
246 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
247 2978161719 Serratia marcescens KZ2 Isolate Apidae
248 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
249 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
250 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
251 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
252 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
253 8018312681 Enterobacter sp. OLF Isolate Tephritidae
254 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
255 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
256 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
257 8069748016 Caballeronia sp. LP003 Isolate Coreidae
258 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
259 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
260 8102109360 Caballeronia sp. INML2 Isolate Coreidae
261 8102145433 Caballeronia sp. LP006 Isolate Coreidae
262 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
263 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
264 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160459_102089 3300012831 Unclassified 3482
2 Ga0466701_028580 3300042598 Bacteria 18128
3 Ga0466730_038260 3300042625 Unclassified 3441
4 Ga0466730_038563 3300042625 Unclassified 97380
5 Ga0466724_31803 3300042649 Bacteria 19762
6 Ga0466724_36510 3300042649 Bacteria 2804
7 Ga0466725_043776 3300042654 Bacteria 6765
8 FGTW_contig26805 2065487013 Unclassified 30361
9 FGTW_contig33186 2065487013 Unclassified 1762
10 SWWA_contig31643__length_39767___numreads_2414 2100351016 Bacteria 39767
11 Meta3P_1001557 3300002464 Unclassified 3849
12 Ga0063521_1000006 3300003973 Bacteria 230945
13 Ga0102736_1000770 3300007052 Bacteria 6055
14 Ga0103265_1000299 3300007068 Bacteria 8241
15 Ga0102739_1000514 3300007095 Unclassified 7755
16 Ga0105005_1042976 3300007505 Unclassified 11724
17 Ga0160447_101371 3300012849 Unclassified 9557
18 Ga0160436_1016882 3300012861 Unclassified 1450
19 Ga0466713_014081 3300042602 Bacteria 234884
20 Ga0466730_000896 3300042625 Bacteria 1356
21 Ga0466730_082332 3300042625 Bacteria 6475
22 Ga0466725_119246 3300042654 Bacteria 4058
23 DPOL_contig06450 2035918003 Bacteria 1180
24 FGTW_contig33001 2065487013 Unclassified 1922
25 HBC_ctgsDRAFT_1009175 3300000333 Bacteria 2346
26 CVPL005W_1009246 3300002934 Unclassified 1656
27 Ga0103266_1000124 3300007067 Bacteria 26330
28 Ga0104041_1002451 3300007106 Unclassified 6457
29 Ga0103268_1000468 3300007192 Bacteria 12452
30 Ga0103268_1002880 3300007192 Bacteria 3712
31 Ga0160448_105089 3300012854 Unclassified 3518
32 Ga0316159_11047 3300030930 Bacteria 4742
33 Ga0466693_409881 3300042592 Bacteria 6813
34 Ga0466707_094643 3300042601 Bacteria 1509
35 Ga0466730_005340 3300042625 Bacteria 3675
36 Ga0466730_044645 3300042625 Bacteria 1865
37 Ga0466724_04203 3300042649 Bacteria 53476
38 Ga0466724_49261 3300042649 Bacteria 63532
39 Ga0160442_100306 3300012806 Bacteria 26599
40 DPO_contig00075 2032320009 Unclassified 12849
41 SPBB_contig11600 2044078006 Unclassified 19837
42 SPBB_contig11636 2044078006 Bacteria 9105
43 Meta3P_1003733 3300002464 Unclassified 4152
44 Ga0103265_1004659 3300007068 Bacteria 1937
45 Ga0103261_1000173 3300007083 Bacteria 11433
46 Ga0103261_1004875 3300007083 Bacteria 2001
47 Ga0102737_1001403 3300007142 Bacteria 6748
48 Ga0562375_0033 3300056856 Bacteria 624816
49 Ga0160452_100043 3300012834 Unclassified 183151
50 Ga0160433_120519 3300012846 Unclassified 782
51 Ga0466701_049869 3300042598 Bacteria 141978
52 Ga0466709_253460 3300042648 Bacteria 11780
53 Ga0466724_05663 3300042649 Unclassified 7001
54 Ga0466724_63399 3300042649 Unclassified 1136
55 DPOL_contig11880 2035918003 Bacteria 33256
56 DPOL_contig13675 2035918003 Unclassified 13992
57 SWWA_contig24484__length_2280___numreads_39 2100351016 Unclassified 2280
58 JGI24696J40584_12948057 3300002834 Bacteria 1983
59 Ga0103263_105763 3300007042 Unclassified 1392
60 Ga0103266_1000030 3300007067 Bacteria 65303
61 Ga0102734_1001103 3300007129 Bacteria 6860
62 Ga0104019_1194898 3300007150 Unclassified 1277
63 Ga0105005_1276846 3300007505 Unclassified 2844
64 Ga0160453_100577 3300012814 Unclassified 25252
65 Ga0160467_102241 3300012829 Bacteria 4637
66 Ga0160433_100200 3300012846 Bacteria 48402
67 Ga0160435_1000434 3300012857 Bacteria 14325
68 Ga0160436_1004913 3300012861 Bacteria 3156
69 Ga0466701_063769 3300042598 Bacteria 151198
70 Ga0160465_100363 3300012803 Bacteria 25628
71 SWWA_contig32505__length_1273___numreads_25 2100351016 Bacteria 1273
72 CVPL010L_1000283 3300002932 Unclassified 13180
73 Ga0103260_1000351 3300007139 Bacteria 9217
74 Ga0103260_1001478 3300007139 Unclassified 4200
75 Ga0102740_1002044 3300007140 Unclassified 7192
76 Ga0103264_1000164 3300007188 Bacteria 38481
77 Ga0103264_1000384 3300007188 Bacteria 24020
78 Ga0103267_1028257 3300007190 Bacteria 1870
79 Ga0105553_1018467 3300007767 Unclassified 5023
80 Ga0160467_101220 3300012829 Unclassified 11649
81 Ga0466701_092881 3300042598 Bacteria 1172
82 Ga0466713_064612 3300042602 Bacteria 2667
83 Ga0466730_038303 3300042625 Bacteria 6932
84 Ga0466730_081934 3300042625 Bacteria 1783
85 Ga0466724_64720 3300042649 Unclassified 9652
86 CVPL010W_10000003 3300002931 Bacteria 118695
87 CVPL010W_10000815 3300002931 Bacteria 35180
88 CVPL005W_1000911 3300002934 Bacteria 9494
89 Ga0104042_1123405 3300007130 Bacteria 1439
90 Ga0104044_1020226 3300007136 Unclassified 2273
91 Ga0102740_1000001 3300007140 Bacteria 144366
92 Ga0102737_1017408 3300007142 Bacteria 1133
93 Ga0104040_1149057 3300007149 Bacteria 1285
94 Ga0562377_0001 3300056842 Bacteria 5082480
95 Ga0265387_1000032 3300024582 Bacteria 53128
96 Ga0255572_1000003 3300026175 Bacteria 262489
97 Ga0466713_148277 3300042602 Bacteria 181035
98 Ga0466730_019320 3300042625 Bacteria 147177
99 Ga0466730_054947 3300042625 Bacteria 59975
100 Ga0466724_17617 3300042649 Unclassified 2803
101 DPOL_contig02480 2035918003 Bacteria 30675
102 Meta3P_1000328 3300002464 Bacteria 80534
103 Meta3P_1001554 3300002464 Bacteria 12775
104 CVPL010W_10009178 3300002931 Bacteria 9071
105 CVPL010L_1002714 3300002932 Unclassified 3426
106 Ga0102738_1000010 3300007141 Bacteria 107934
107 Ga0103267_1048542 3300007190 Bacteria 1392
108 Ga0160460_100928 3300012845 Unclassified 12477
109 Ga0265387_1000656 3300024582 Bacteria 5344
110 Ga0466701_021959 3300042598 Bacteria 104761
111 Ga0466701_033267 3300042598 Bacteria 1669
112 FGTW_contig27111 2065487013 Unclassified 1371
113 SWWA_contig24645__length_2599___numreads_38 2100351016 Unclassified 2599
114 CVPL010W_10004945 3300002931 Bacteria 14542
115 Ga0074188_1000412 3300005318 Bacteria 30301
116 Ga0103263_106911 3300007042 Bacteria 1237

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13977 TetR_C_6 BetI-type transcriptional repressor, C-terminal 87 195 0.97
PF00440 TetR_N Bacterial regulatory proteins, tetR family 18 62 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.