Protein Family IF03880

Metagenome Isolate
129 Members
37 Samples
125 Scaffolds
474.67 Avg Length

🧬 Representative Sequence

ID
3300012845|Ga0160460_100029|Ga0160460_10002965
Length
474 aa
Sequence
MTKHNFKIGLFGIGLDTYWPQFKGLEQRLIGYLAQVETKISAYGAEVLNLGLIDNADKAFTAGHDFKKGDVDVIFLYVTTYALSSTVLPVVRRAKVPVIILNLVPEKAIDYKNFNQLKDRTKMTGDWLAFCSACPVPEIANVFKRSGIQFHQVTGVLNDEETWEEIGDWVEVAKVVHTMSHNTLGLMGNYYSGMLDIYSDLTLQCAVFGNHIEIIEPDELTALRDDATESEVKAKTEEFKKLFEIDSSCEEVELDKAAKTAVALDKLVNQYDLGSMAYYHNGTGNANADTMSSIILGNSILTAKGIPVAGEYEVKNAQAMKIMDSFGVGGSFTEYYAMDFEDDVVLMGHDGPGHLAIAEGKIKVKPLQVYHGKVGSGLSVEMSVKHGPVTLLSVVESNCKIFLLIAEGESVAGPILEIGNTNSRYCFPIGAKKFTENWNNNGPAHHCAVGIGHIGNKLIKLAGLLNIEVIKIC*

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 21.6%
Unclassified 16.2%
Termopsidae 10.8%
Rhinotermitidae 8.1%
Culicidae 2.7%
Passalidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
7 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
8 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_478499 3300042612 Bacteria 12196
2 Ga0466715_643669 3300042616 Bacteria 9131
3 Ga0466723_050067 3300042618 Bacteria 11000
4 Ga0466703_039954 3300042636 Bacteria 32713
5 Ga0466703_313520 3300042636 Bacteria 4911
6 Ga0466709_086644 3300042648 Bacteria 14610
7 Ga0466707_059515 3300042601 Bacteria 7530
8 Ga0466707_385406 3300042601 Bacteria 3232
9 Ga0466722_111299 3300042609 Bacteria 5447
10 AustNasuHG_c1001812 3300000089 Bacteria 7726
11 Ga0466705_074875 3300042612 Bacteria 7147
12 Ga0466715_002824 3300042616 Bacteria 4668
13 Ga0466723_078084 3300042618 Bacteria 4652
14 Ga0466723_101273 3300042618 Bacteria 2584
15 Ga0466723_165567 3300042618 Bacteria 20094
16 Ga0466728_409675 3300042620 Bacteria 5348
17 Ga0466691_039484 3300042593 Bacteria 2638
18 Ga0466696_022203 3300042596 Bacteria 14217
19 Ga0466735_038210 3300042624 Bacteria 5486
20 Ga0466735_113511 3300042624 Bacteria 7473
21 Ga0466735_157124 3300042624 Bacteria 1637
22 Ga0466704_021545 3300042643 Bacteria 11269
23 Ga0466704_037431 3300042643 Bacteria 18136
24 Ga0466704_212927 3300042643 Bacteria 11858
25 Ga0466727_014874 3300042655 Bacteria 3136
26 Ga0466722_004292 3300042609 Bacteria 12485
27 JGI24702J35022_10001607 3300002462 Bacteria 13958
28 Ga0466733_179449 3300042659 Bacteria 3251
29 Ga0466715_052253 3300042616 Bacteria 13554
30 Ga0466723_243642 3300042618 Bacteria 11920
31 Ga0466726_124996 3300042619 Bacteria 1737
32 Ga0466726_409601 3300042619 Bacteria 2537
33 Ga0160460_100029 3300012845 Bacteria 324685
34 Ga0466690_074668 3300042590 Bacteria 8168
35 Ga0466696_127513 3300042596 Unclassified 2304
36 Ga0466704_213973 3300042643 Bacteria 2162
37 Ga0466708_296578 3300042652 Bacteria 35153
38 Ga0466727_077675 3300042655 Bacteria 3279
39 Ga0466727_221814 3300042655 Bacteria 2386
40 Ga0123353_10490906 3300010167 Bacteria 1793
41 Ga0466716_333668 3300042605 Bacteria 12616
42 Ga0466719_553372 3300042606 Bacteria 3338
43 JGI24705J35276_12233570 3300002504 Bacteria 4919
44 Ga0466705_229487 3300042612 Bacteria 9029
45 Ga0466733_074294 3300042659 Bacteria 93274
46 Ga0466715_092390 3300042616 Bacteria 8687
47 Ga0466715_117066 3300042616 Bacteria 10570
48 Ga0466715_262591 3300042616 Bacteria 13449
49 Ga0466715_505316 3300042616 Bacteria 4231
50 Ga0466728_450217 3300042620 Bacteria 7769
51 Ga0466694_155148 3300042594 Bacteria 33595
52 Ga0466696_080636 3300042596 Bacteria 10674
53 Ga0466696_083196 3300042596 Bacteria 7799
54 Ga0466703_014879 3300042636 Bacteria 9207
55 Ga0466703_297833 3300042636 Bacteria 1937
56 Ga0123353_10051001 3300010167 Bacteria 6601
57 Ga0466713_115352 3300042602 Bacteria 29236
58 Ga0466713_156527 3300042602 Bacteria 3915
59 Ga0466716_173848 3300042605 Bacteria 43531
60 Ga0466719_119564 3300042606 Bacteria 14100
61 Ga0466719_146117 3300042606 Bacteria 1825
62 Ga0466705_064830 3300042612 Bacteria 19081
63 Ga0466705_069841 3300042612 Bacteria 12967
64 Ga0466711_445925 3300042615 Bacteria 3283
65 Ga0466726_097980 3300042619 Bacteria 2571
66 Ga0466726_427978 3300042619 Bacteria 2043
67 Ga0466696_015634 3300042596 Bacteria 13458
68 Ga0466696_133294 3300042596 Bacteria 14875
69 Ga0466727_013197 3300042655 Bacteria 14073
70 Ga0466727_294687 3300042655 Bacteria 4191
71 Ga0466707_407335 3300042601 Bacteria 27153
72 Ga0466713_022472 3300042602 Bacteria 48965
73 Ga0466713_134683 3300042602 Bacteria 1778
74 Ga0466719_397574 3300042606 Bacteria 3624
75 Ga0068302_10106391 3300005071 Bacteria 1737
76 Ga0466705_105915 3300042612 Bacteria 14879
77 Ga0466711_224242 3300042615 Bacteria 29340
78 Ga0466711_233811 3300042615 Bacteria 27406
79 Ga0466723_151775 3300042618 Bacteria 1930
80 Ga0466690_093332 3300042590 Bacteria 19968
81 Ga0466692_107738 3300042591 Bacteria 10153
82 Ga0466691_079817 3300042593 Bacteria 16366
83 Ga0466694_206587 3300042594 Bacteria 6907
84 Ga0466696_066748 3300042596 Bacteria 4348
85 Ga0466704_390074 3300042643 Bacteria 4409
86 Ga0466708_367106 3300042652 Bacteria 72455
87 Ga0466727_110796 3300042655 Bacteria 2691
88 Ga0466707_022609 3300042601 Bacteria 2607
89 Ga0466707_382905 3300042601 Bacteria 3267
90 Ga0466713_047571 3300042602 Bacteria 55256
91 Ga0466713_144658 3300042602 Bacteria 46382
92 AustNasuHG_c1002678 3300000089 Bacteria 6431
93 JGI24698J34947_10009301 3300002449 Bacteria 5394
94 Ga0466691_097197 3300042593 Bacteria 15697
95 Ga0466696_396070 3300042596 Bacteria 2802
96 Ga0466735_195684 3300042624 Bacteria 2717
97 Ga0466703_062086 3300042636 Bacteria 35310
98 Ga0466703_421040 3300042636 Bacteria 5537
99 Ga0466704_034204 3300042643 Bacteria 4192
100 Ga0466704_076070 3300042643 Bacteria 1862
101 Ga0466709_088187 3300042648 Bacteria 9559
102 Ga0466709_199923 3300042648 Bacteria 96862
103 Ga0123353_10004495 3300010167 Bacteria 17967
104 Ga0123353_10098710 3300010167 Bacteria 4706
105 Ga0123353_10131298 3300010167 Bacteria 4019
106 Ga0466707_261484 3300042601 Bacteria 6462
107 Ga0466713_010490 3300042602 Bacteria 17574
108 Ga0466713_123635 3300042602 Bacteria 23342
109 Ga0466714_028618 3300042603 Bacteria 1845
110 JGI24702J35022_10017051 3300002462 Bacteria 3975
111 Ga0466715_181152 3300042616 Bacteria 7680
112 Ga0466715_337385 3300042616 Bacteria 28368
113 Ga0466728_481213 3300042620 Bacteria 2337
114 Ga0466690_161436 3300042590 Bacteria 18447
115 Ga0466696_171156 3300042596 Bacteria 4650
116 Ga0466696_350726 3300042596 Bacteria 10131
117 Ga0466729_278325 3300042621 Bacteria 8029
118 Ga0466735_104045 3300042624 Bacteria 2215
119 Ga0466735_122133 3300042624 Bacteria 18547
120 Ga0466703_024275 3300042636 Bacteria 27229
121 Ga0466727_213061 3300042655 Bacteria 8411
122 Ga0466713_002210 3300042602 Bacteria 6334
123 Ga0466716_100090 3300042605 Bacteria 4538
124 IMNBL1DRAFT_c0012341 3300000062 Bacteria 3914
125 Ga0068305_10066638 3300005083 Bacteria 13829

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_039484 Ga0466691_039484_802_2106 434
2 3300042618 Ga0466723_151775 Ga0466723_151775_341_1681 446
3 3300042624 Ga0466735_038210 Ga0466735_038210_1221_2642 446
4 3300042620 Ga0466728_481213 Ga0466728_481213_772_2154 460
5 3300042636 Ga0466703_039954 Ga0466703_039954_13085_14479 464
6 3300042612 Ga0466705_229487 Ga0466705_229487_4558_5955 465
7 3300042612 Ga0466705_064830 Ga0466705_064830_4396_5802 468
8 3300042620 Ga0466728_450217 Ga0466728_450217_1811_3217 468
9 3300002462 JGI24702J35022_10017051 JGI24702J35022_100170514 469
10 3300042593 Ga0466691_079817 Ga0466691_079817_4755_6164 469
11 3300042601 Ga0466707_385406 Ga0466707_385406_870_2279 469
12 3300042618 Ga0466723_050067 Ga0466723_050067_5873_7282 469
13 3300042636 Ga0466703_014879 Ga0466703_014879_7497_8906 469
14 3300042659 Ga0466733_074294 Ga0466733_074294_3934_5343 469
15 iso_pr_bacteria 2820750388 2820750711 469
16 3300002449 JGI24698J34947_10009301 JGI24698J34947_100093012 470
17 3300042615 Ga0466711_445925 Ga0466711_445925_577_1989 470
18 3300042643 Ga0466704_021545 Ga0466704_021545_344_1756 470
19 3300042643 Ga0466704_034204 Ga0466704_034204_2064_3476 470
20 3300002504 JGI24705J35276_12233570 JGI24705J35276_122335704 471
21 3300042593 Ga0466691_097197 Ga0466691_097197_1106_2521 471
22 3300042596 Ga0466696_015634 Ga0466696_015634_4234_5649 471
23 3300042596 Ga0466696_127513 Ga0466696_127513_187_1602 471
24 3300042601 Ga0466707_382905 Ga0466707_382905_666_2081 471
25 3300042602 Ga0466713_115352 Ga0466713_115352_12197_13612 471
26 3300042605 Ga0466716_173848 Ga0466716_173848_6831_8246 471
27 3300042616 Ga0466715_052253 Ga0466715_052253_8004_9419 471
28 3300042616 Ga0466715_643669 Ga0466715_643669_4205_5620 471
29 3300042596 Ga0466696_171156 Ga0466696_171156_779_2197 472
30 3300042606 Ga0466719_146117 Ga0466719_146117_390_1808 472
31 3300042615 Ga0466711_224242 Ga0466711_224242_14567_15985 472
32 3300042655 Ga0466727_077675 Ga0466727_077675_1394_2812 472
33 3300042590 Ga0466690_093332 Ga0466690_093332_13320_14741 473
34 3300042590 Ga0466690_161436 Ga0466690_161436_6369_7790 473
35 3300042594 Ga0466694_155148 Ga0466694_155148_8740_10161 473
36 3300042596 Ga0466696_133294 Ga0466696_133294_4954_6375 473
37 3300042596 Ga0466696_350726 Ga0466696_350726_2635_4056 473
38 3300042601 Ga0466707_261484 Ga0466707_261484_2799_4220 473
39 3300042601 Ga0466707_407335 Ga0466707_407335_22187_23608 473
40 3300042602 Ga0466713_002210 Ga0466713_002210_3784_5205 473
41 3300042602 Ga0466713_144658 Ga0466713_144658_40607_42028 473
42 3300042602 Ga0466713_156527 Ga0466713_156527_375_1796 473
43 3300042606 Ga0466719_397574 Ga0466719_397574_878_2299 473
44 3300042606 Ga0466719_553372 Ga0466719_553372_237_1658 473
45 3300042612 Ga0466705_069841 Ga0466705_069841_11351_12772 473
46 3300042612 Ga0466705_105915 Ga0466705_105915_10620_12041 473
47 3300042612 Ga0466705_478499 Ga0466705_478499_8080_9501 473
48 3300042615 Ga0466711_233811 Ga0466711_233811_5457_6878 473
49 3300042616 Ga0466715_181152 Ga0466715_181152_882_2303 473
50 3300042618 Ga0466723_078084 Ga0466723_078084_234_1655 473
51 3300042618 Ga0466723_165567 Ga0466723_165567_8789_10210 473
52 3300042619 Ga0466726_124996 Ga0466726_124996_22_1443 473
53 3300042620 Ga0466728_409675 Ga0466728_409675_317_1738 473
54 3300042621 Ga0466729_278325 Ga0466729_278325_4838_6259 473
55 3300042624 Ga0466735_104045 Ga0466735_104045_440_1861 473
56 3300042624 Ga0466735_113511 Ga0466735_113511_2472_3893 473
57 3300042624 Ga0466735_157124 Ga0466735_157124_126_1547 473
58 3300042624 Ga0466735_195684 Ga0466735_195684_193_1614 473
59 3300042636 Ga0466703_024275 Ga0466703_024275_11268_12689 473
60 3300042636 Ga0466703_313520 Ga0466703_313520_1741_3162 473
61 3300042636 Ga0466703_421040 Ga0466703_421040_1143_2564 473
62 3300042643 Ga0466704_037431 Ga0466704_037431_5289_6710 473
63 3300042652 Ga0466708_296578 Ga0466708_296578_32825_34246 473
64 3300042655 Ga0466727_014874 Ga0466727_014874_1292_2713 473
65 3300042659 Ga0466733_179449 Ga0466733_179449_641_2062 473
66 iso_pr_bacteria 2781125629 2781263074 473
67 iso_pr_bacteria 2967483437 2967483969 473
68 iso_pr_bacteria 2967483437 2967484723 473
69 3300000062 IMNBL1DRAFT_c0012341 IMNBL1DRAFT_00123413 474
70 3300000089 AustNasuHG_c1001812 AustNasuHG_10018125 474
71 3300000089 AustNasuHG_c1002678 AustNasuHG_10026784 474
72 3300010167 Ga0123353_10004495 Ga0123353_1000449510 474
73 3300012845 Ga0160460_100029 Ga0160460_10002965 474
74 3300042590 Ga0466690_074668 Ga0466690_074668_630_2054 474
75 3300042594 Ga0466694_206587 Ga0466694_206587_728_2152 474
76 3300042596 Ga0466696_022203 Ga0466696_022203_3166_4590 474
77 3300042596 Ga0466696_080636 Ga0466696_080636_2240_3664 474
78 3300042602 Ga0466713_123635 Ga0466713_123635_9073_10497 474
79 3300042605 Ga0466716_100090 Ga0466716_100090_2916_4340 474
80 3300042609 Ga0466722_111299 Ga0466722_111299_3741_5165 474
81 3300042624 Ga0466735_122133 Ga0466735_122133_2861_4285 474
82 3300042648 Ga0466709_199923 Ga0466709_199923_30089_31513 474
83 3300002462 JGI24702J35022_10001607 JGI24702J35022_100016072 475
84 3300010167 Ga0123353_10051001 Ga0123353_100510013 475
85 3300010167 Ga0123353_10490906 Ga0123353_104909062 475
86 3300042591 Ga0466692_107738 Ga0466692_107738_7197_8624 475
87 3300042602 Ga0466713_047571 Ga0466713_047571_50407_51834 475
88 3300042609 Ga0466722_004292 Ga0466722_004292_6289_7716 475
89 3300042618 Ga0466723_243642 Ga0466723_243642_9975_11402 475
90 3300042619 Ga0466726_427978 Ga0466726_427978_27_1454 475
91 3300042652 Ga0466708_367106 Ga0466708_367106_7973_9400 475
92 3300042655 Ga0466727_294687 Ga0466727_294687_874_2301 475
93 3300010167 Ga0123353_10131298 Ga0123353_101312983 476
94 3300042601 Ga0466707_059515 Ga0466707_059515_3537_4967 476
95 3300042602 Ga0466713_010490 Ga0466713_010490_1572_3002 476
96 3300042606 Ga0466719_119564 Ga0466719_119564_282_1712 476
97 3300042616 Ga0466715_002824 Ga0466715_002824_2466_3896 476
98 3300042636 Ga0466703_297833 Ga0466703_297833_483_1913 476
99 3300042643 Ga0466704_213973 Ga0466704_213973_210_1640 476
100 3300042655 Ga0466727_110796 Ga0466727_110796_744_2174 476
101 3300005083 Ga0068305_10066638 Ga0068305_100666383 477
102 3300042603 Ga0466714_028618 Ga0466714_028618_329_1762 477
103 3300042648 Ga0466709_086644 Ga0466709_086644_6224_7657 477
104 3300010167 Ga0123353_10098710 Ga0123353_100987105 478
105 3300042601 Ga0466707_022609 Ga0466707_022609_583_2019 478
106 3300042612 Ga0466705_074875 Ga0466705_074875_5260_6696 478
107 3300042616 Ga0466715_092390 Ga0466715_092390_2629_4065 478
108 3300042616 Ga0466715_262591 Ga0466715_262591_6090_7526 478
109 3300042616 Ga0466715_337385 Ga0466715_337385_17613_19049 478
110 3300042619 Ga0466726_097980 Ga0466726_097980_613_2049 478
111 3300005071 Ga0068302_10106391 Ga0068302_101063911 479
112 3300042648 Ga0466709_088187 Ga0466709_088187_1400_2839 479
113 3300042618 Ga0466723_101273 Ga0466723_101273_1120_2565 481
114 3300042655 Ga0466727_221814 Ga0466727_221814_269_1714 481
115 3300042596 Ga0466696_083196 Ga0466696_083196_2965_4413 482
116 3300042602 Ga0466713_134683 Ga0466713_134683_102_1550 482
117 3300042616 Ga0466715_117066 Ga0466715_117066_1112_2560 482
118 3300042636 Ga0466703_062086 Ga0466703_062086_7766_9214 482
119 3300042643 Ga0466704_390074 Ga0466704_390074_605_2053 482
120 3300042655 Ga0466727_013197 Ga0466727_013197_2766_4217 483
121 3300042619 Ga0466726_409601 Ga0466726_409601_178_1635 485
122 3300042605 Ga0466716_333668 Ga0466716_333668_33_1493 486
123 3300042643 Ga0466704_212927 Ga0466704_212927_3832_5295 487
124 3300042602 Ga0466713_022472 Ga0466713_022472_10094_11560 488
125 3300042643 Ga0466704_076070 Ga0466704_076070_361_1845 494
126 3300042655 Ga0466727_213061 Ga0466727_213061_6858_8351 497
127 3300042596 Ga0466696_066748 Ga0466696_066748_1852_3357 501
128 3300042596 Ga0466696_396070 Ga0466696_396070_1081_2610 509
129 3300042616 Ga0466715_505316 Ga0466715_505316_370_1971 533

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF11762 Arabinose_Iso_C L-arabinose isomerase C-terminal domain 330 468 0.94
PF02952 Fucose_iso_C L-fucose isomerase, C-terminal domain 364 470 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.