Protein Family IF03833

Metagenome Isolate
406 Members
117 Samples
368 Scaffolds
258.74 Avg Length

🧬 Representative Sequence

ID
3300012837|Ga0160455_100168|Ga0160455_1001685
Length
324 aa
Sequence
MKLNLKRPLAFFDLEATGTIIGFDRIVEIAVLKVFPDGSKEMKNARINPEMPIPLETSLIHGIYDEDIKDAPTFKQAGPEFAAFLDDCDLAGYNSNKFDIPMLMDEFLRAGVPFDIDNRKFVDVQNIFHQMEQRTLKAAYKFYCGKSLENAHNADADTMATYEVLLGQLERYKDVEFVDKKGNVSVPVKNDVDALHEFTNLHNPVDFAGRLVFNEQGVEVFNFGKHKGKCVEEVFQAEPSYYSWMQNGDFPLYTKKCLEKIWVRWNEKKVLVKKTTETKIEVESPRTVTPRKDNDTRPIFKKKESAAPVTDSMLDELKKKFGK*

πŸ“Š Sample Types

Isolate 9.4%
Metagenome 90.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 22.5%
Blattidae 14.4%
Kalotermitidae 12.6%
Culicidae 9.0%
Elmidae 7.2%
Unclassified 6.3%
Formicidae 5.4%
Drosophilidae 4.5%
Armadillidiidae 3.6%
Termopsidae 3.6%
Rhinotermitidae 2.7%
Passalidae 1.8%
Delphacidae 0.9%
Hodotermitidae 0.9%
Pyroglyphidae 0.9%
Aphelinidae 0.9%
Hydrophilidae 0.9%
Daphniidae 0.9%
Cambaridae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 389
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
2 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
3 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
4 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
5 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
6 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
7 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
8 3000336795 Cardinium endosymbiont of Sogatella furcifera cSfur Isolate Delphacidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
11 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
12 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
13 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
27 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
30 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
31 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
32 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2864836148 Arcicella rosea S00070 Isolate Elmidae
37 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
38 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
39 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
42 3000153175 Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 Isolate Pyroglyphidae
43 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
44 3300003131 Encarsia pergandiella symbiont microbial communities from Weslaco, Texas Metagenome Aphelinidae
45 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
46 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
47 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
48 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
49 2998907766 Penaeicola halotolerans LMIT005 Isolate
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
52 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
53 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
54 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
61 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
62 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
63 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
64 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
65 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
68 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
69 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
70 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
71 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
72 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
73 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
74 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
75 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
76 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
77 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
78 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
79 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
80 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
81 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
82 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
83 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
84 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
85 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
86 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
87 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
88 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
89 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
90 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
91 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
92 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
93 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
94 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
95 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
96 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
97 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
98 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
99 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
100 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
101 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
102 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
103 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
104 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
105 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
106 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
107 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
108 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
109 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
110 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
111 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
112 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
113 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
114 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
115 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
116 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
117 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_226040 3300042612 Bacteria 8446
2 Ga0466705_351700 3300042612 Bacteria 17139
3 Ga0123355_10143753 3300009826 Bacteria 3643
4 Ga0123356_10024068 3300010049 Bacteria 5732
5 Ga0123353_10065628 3300010167 Bacteria 5828
6 Ga0123353_10170571 3300010167 Bacteria 3454
7 Ga0123354_10001055 3300010882 Bacteria 31731
8 Ga0123354_10202565 3300010882 Bacteria 2176
9 Ga0123354_10329157 3300010882 Bacteria 1396
10 Ga0466723_137868 3300042618 Bacteria 7658
11 Ga0466726_021927 3300042619 Bacteria 10677
12 Ga0466726_081325 3300042619 Bacteria 12183
13 Ga0466726_294712 3300042619 Bacteria 4755
14 Ga0466690_035035 3300042590 Bacteria 7256
15 Ga0466690_276223 3300042590 Bacteria 213056
16 Ga0466690_309291 3300042590 Bacteria 26834
17 Ga0466692_054187 3300042591 Bacteria 12714
18 Ga0466694_066036 3300042594 Bacteria 3117
19 Ga0466696_010546 3300042596 Bacteria 6133
20 Ga0466696_078846 3300042596 Bacteria 1525
21 Ga0466701_032214 3300042598 Bacteria 43207
22 Ga0466701_033049 3300042598 Bacteria 2505
23 Ga0466701_102428 3300042598 Bacteria 44442
24 Ga0466706_071532 3300042599 Bacteria 22220
25 Ga0466706_154787 3300042599 Unclassified 1081
26 Ga0466706_269132 3300042599 Bacteria 1562
27 Ga0466700_425448 3300042600 Bacteria 2346
28 Ga0466707_163242 3300042601 Bacteria 1214
29 Ga0466713_012145 3300042602 Bacteria 43474
30 Ga0466713_099716 3300042602 Bacteria 24500
31 Ga0466713_115233 3300042602 Bacteria 28611
32 Ga0466713_132210 3300042602 Bacteria 46954
33 Ga0466714_081810 3300042603 Bacteria 2793
34 Ga0466716_102860 3300042605 Bacteria 7682
35 Ga0466716_256212 3300042605 Bacteria 4943
36 Ga0466719_282293 3300042606 Bacteria 5829
37 Ga0466719_303945 3300042606 Bacteria 21889
38 Ga0466722_084826 3300042609 Bacteria 2766
39 Ga0466722_266222 3300042609 Bacteria 11755
40 Ga0466735_112809 3300042624 Bacteria 5593
41 Ga0466735_145772 3300042624 Bacteria 2686
42 Ga0466730_097984 3300042625 Bacteria 727286
43 Ga0466703_421965 3300042636 Bacteria 9078
44 Ga0466704_072664 3300042643 Bacteria 13812
45 Ga0466704_165577 3300042643 Bacteria 8486
46 Ga0466704_536150 3300042643 Bacteria 4736
47 Ga0466724_28381 3300042649 Bacteria 68129
48 Ga0466724_43696 3300042649 Bacteria 561295
49 Ga0466727_210639 3300042655 Bacteria 23496
50 2227344678 2225789004 Bacteria 6221
51 IMNBL1DRAFT_c0004497 3300000062 Bacteria 8344
52 IMNBL1DRAFT_c0011574 3300000062 Bacteria 4112
53 IMNBL1DRAFT_c0055349 3300000062 Bacteria 1224
54 Ga0068305_10070753 3300005083 Bacteria 8625
55 Ga0072941_1015407 3300005201 Bacteria 4683
56 Ga0104048_1022272 3300007143 Unclassified 7387
57 Ga0104050_1001574 3300007153 Bacteria 3986
58 Ga0103264_1000022 3300007188 Bacteria 178022
59 Ga0466733_010468 3300042659 Bacteria 13856
60 Ga0123357_10007571 3300009784 Bacteria 13441
61 Ga0123357_10046079 3300009784 Bacteria 5914
62 Ga0123357_10157910 3300009784 Bacteria 2729
63 Ga0123354_10000042 3300010882 Bacteria 95103
64 Ga0466711_009583 3300042615 Bacteria 1517
65 Ga0466711_090299 3300042615 Bacteria 47995
66 Ga0466711_097396 3300042615 Bacteria 1795
67 Ga0466711_243391 3300042615 Unclassified 4490
68 Ga0466711_290361 3300042615 Bacteria 2573
69 Ga0466715_194192 3300042616 Bacteria 7344
70 Ga0466723_225795 3300042618 Bacteria 13841
71 Ga0466728_222413 3300042620 Bacteria 18136
72 Ga0466729_170334 3300042621 Bacteria 11027
73 Ga0466657_076183 3300042582 Bacteria 1031
74 Ga0466690_027177 3300042590 Bacteria 32769
75 Ga0466690_223698 3300042590 Bacteria 3031
76 Ga0466690_421784 3300042590 Bacteria 2234
77 Ga0466706_093516 3300042599 Bacteria 5540
78 Ga0466706_275766 3300042599 Bacteria 6742
79 Ga0466700_271005 3300042600 Bacteria 7253
80 Ga0466700_373334 3300042600 Bacteria 80469
81 Ga0466714_051789 3300042603 Bacteria 2773
82 Ga0466714_054269 3300042603 Bacteria 2644
83 Ga0466714_121039 3300042603 Bacteria 2824
84 Ga0466714_140143 3300042603 Bacteria 3498
85 Ga0466717_157090 3300042604 Bacteria 2401
86 Ga0466722_110099 3300042609 Bacteria 3107
87 Ga0466722_216541 3300042609 Bacteria 1681
88 Ga0466698_029784 3300042610 Bacteria 1684
89 Ga0466703_007766 3300042636 Bacteria 11395
90 Ga0466703_008945 3300042636 Bacteria 15665
91 Ga0466708_298706 3300042652 Bacteria 13911
92 Ga0466708_422671 3300042652 Bacteria 12116
93 IMNBL1DRAFT_c0002818 3300000062 Bacteria 11728
94 JGI24702J35022_10001206 3300002462 Bacteria 16080
95 JGI24705J35276_12220383 3300002504 Bacteria 2264
96 JGI24696J40584_12941766 3300002834 Bacteria 1719
97 Ga0123357_10014799 3300009784 Bacteria 10199
98 Ga0466711_008524 3300042615 Unclassified 1517
99 Ga0466711_135661 3300042615 Bacteria 2025
100 Ga0466711_240969 3300042615 Bacteria 7232
101 Ga0466715_066146 3300042616 Bacteria 20129
102 Ga0466715_087433 3300042616 Bacteria 28443
103 Ga0466715_468054 3300042616 Bacteria 39701
104 Ga0466723_250641 3300042618 Bacteria 2637
105 Ga0466726_328888 3300042619 Bacteria 4079
106 Ga0466728_200547 3300042620 Bacteria 11228
107 Ga0160460_100032 3300012845 Bacteria 316932
108 Ga0160435_1000007 3300012857 Unclassified 269526
109 Ga0466690_218956 3300042590 Bacteria 9965
110 Ga0466690_403369 3300042590 Bacteria 6141
111 Ga0466693_226172 3300042592 Bacteria 1919
112 Ga0466691_023858 3300042593 Bacteria 13253
113 Ga0466691_097455 3300042593 Bacteria 32144
114 Ga0466691_128298 3300042593 Bacteria 15773
115 Ga0466696_019438 3300042596 Bacteria 1567
116 Ga0466696_046481 3300042596 Bacteria 9675
117 Ga0466696_166515 3300042596 Bacteria 2849
118 Ga0466707_064540 3300042601 Bacteria 6487
119 Ga0466707_301453 3300042601 Bacteria 14839
120 Ga0466714_009266 3300042603 Bacteria 25729
121 Ga0466714_163273 3300042603 Bacteria 2481
122 Ga0466716_073567 3300042605 Bacteria 13972
123 Ga0466722_066324 3300042609 Bacteria 41323
124 Ga0466734_143514 3300042623 Bacteria 1138
125 Ga0466735_028619 3300042624 Bacteria 1331
126 Ga0466735_066144 3300042624 Bacteria 1655
127 Ga0466735_112070 3300042624 Bacteria 4737
128 Ga0466735_118285 3300042624 Bacteria 8233
129 Ga0466735_224037 3300042624 Bacteria 1247
130 Ga0466704_039096 3300042643 Bacteria 19109
131 Ga0466704_268287 3300042643 Bacteria 2324
132 Ga0466704_288938 3300042643 Bacteria 7496
133 Ga0466724_18164 3300042649 Unclassified 19706
134 Ga0466725_297803 3300042654 Bacteria 25445
135 Ga0466725_425080 3300042654 Bacteria 39967
136 Ga0466727_218918 3300042655 Bacteria 13170
137 IMNBL1DRAFT_c0001371 3300000062 Bacteria 18314
138 IMNBL1DRAFT_c0006017 3300000062 Bacteria 6764
139 JGI24702J35022_10025522 3300002462 Bacteria 3188
140 JGI24699J35502_11028272 3300002509 Bacteria 1494
141 JGI24699J35502_11134100 3300002509 Bacteria 30804
142 Ga0052165_100011 3300003131 Bacteria 19495
143 Ga0068302_10152344 3300005071 Bacteria 5283
144 Ga0068302_10257965 3300005071 Bacteria 2070
145 Ga0104048_1020014 3300007143 Unclassified 1708
146 Ga0466705_017856 3300042612 Bacteria 8827
147 Ga0466705_313939 3300042612 Bacteria 33682
148 Ga0466705_329308 3300042612 Bacteria 3291
149 Ga0466733_026093 3300042659 Bacteria 3466
150 Ga0466733_156576 3300042659 Bacteria 2758
151 Ga0123357_10125341 3300009784 Bacteria 3219
152 Ga0466711_093803 3300042615 Bacteria 25402
153 Ga0466715_085911 3300042616 Bacteria 54416
154 Ga0466715_426091 3300042616 Bacteria 11866
155 Ga0466723_140798 3300042618 Bacteria 5839
156 Ga0466726_032938 3300042619 Bacteria 39699
157 Ga0466728_221899 3300042620 Bacteria 10062
158 Ga0160470_100832 3300012813 Bacteria 9215
159 Ga0466692_092133 3300042591 Bacteria 23837
160 Ga0466696_253210 3300042596 Bacteria 201850
161 Ga0466696_331279 3300042596 Bacteria 5611
162 Ga0466696_470316 3300042596 Bacteria 5614
163 Ga0466701_096044 3300042598 Bacteria 212143
164 Ga0466707_056555 3300042601 Bacteria 8162
165 Ga0466707_191904 3300042601 Bacteria 5003
166 Ga0466713_081632 3300042602 Bacteria 8129
167 Ga0466713_118304 3300042602 Bacteria 7326
168 Ga0466716_349846 3300042605 Bacteria 13854
169 Ga0466719_143847 3300042606 Bacteria 15783
170 Ga0466703_027299 3300042636 Bacteria 10951
171 Ga0466703_221509 3300042636 Bacteria 34236
172 Ga0466704_253317 3300042643 Bacteria 5002
173 Ga0466704_443103 3300042643 Bacteria 3887
174 Ga0466709_099936 3300042648 Bacteria 10023
175 Ga0466708_040867 3300042652 Bacteria 27776
176 Ga0466727_027589 3300042655 Bacteria 4487
177 Ga0466727_141033 3300042655 Bacteria 10075
178 2227465749 2225789004 Bacteria 5170
179 IMNBL1DRAFT_c0002523 3300000062 Unclassified 12677
180 JGI24702J35022_10265291 3300002462 Bacteria 1003
181 Meta3P_1002350 3300002464 Unclassified 10565
182 JGI24705J35276_12206071 3300002504 Bacteria 1712
183 Ga0104045_1076537 3300007085 Bacteria 1667
184 Ga0123357_10001682 3300009784 Bacteria 23806
185 Ga0466705_032507 3300042612 Bacteria 27092
186 Ga0466705_284900 3300042612 Bacteria 5027
187 Ga0466705_378056 3300042612 Bacteria 11596
188 Ga0123357_10414325 3300009784 Bacteria 1210
189 Ga0123354_10017632 3300010882 Bacteria 11188
190 Ga0466715_417726 3300042616 Bacteria 5721
191 Ga0466715_584495 3300042616 Bacteria 8710
192 Ga0466726_238478 3300042619 Bacteria 6103
193 Ga0466728_312262 3300042620 Bacteria 1684
194 Ga0466729_065131 3300042621 Bacteria 3231
195 Ga0160441_100889 3300012825 Bacteria 14393
196 Ga0160455_100168 3300012837 Bacteria 70703
197 Ga0160433_100246 3300012846 Bacteria 38192
198 Ga0160434_100083 3300012850 Unclassified 63208
199 Ga0466690_177182 3300042590 Bacteria 15895
200 Ga0466691_019050 3300042593 Bacteria 28586
201 Ga0466691_140180 3300042593 Bacteria 12996
202 Ga0466696_503453 3300042596 Bacteria 10294
203 Ga0466699_052727 3300042597 Bacteria 1373
204 Ga0466706_025174 3300042599 Bacteria 118676
205 Ga0466706_054207 3300042599 Bacteria 1989
206 Ga0466707_305252 3300042601 Bacteria 3147
207 Ga0466713_009775 3300042602 Bacteria 66246
208 Ga0466713_023394 3300042602 Bacteria 7460
209 Ga0466713_034984 3300042602 Bacteria 13477
210 Ga0466713_124591 3300042602 Bacteria 15803
211 Ga0466716_397792 3300042605 Bacteria 16628
212 Ga0466719_053145 3300042606 Bacteria 15783
213 Ga0466734_014088 3300042623 Bacteria 1981
214 Ga0466703_099136 3300042636 Bacteria 1335
215 Ga0466703_269490 3300042636 Bacteria 1686
216 Ga0466704_142162 3300042643 Bacteria 7889
217 Ga0466704_151538 3300042643 Bacteria 8003
218 Ga0466704_195822 3300042643 Bacteria 13956
219 Ga0466704_207722 3300042643 Bacteria 9000
220 Ga0466704_362592 3300042643 Bacteria 6525
221 Ga0466709_183247 3300042648 Bacteria 3970
222 Ga0466709_369756 3300042648 Bacteria 11117
223 Ga0466708_082974 3300042652 Bacteria 13466
224 Ga0466727_036553 3300042655 Bacteria 2158
225 Ga0068305_10501874 3300005083 Bacteria 5290
226 Ga0074302_1136903 3300005316 Bacteria 1663
227 Ga0103265_1000007 3300007068 Bacteria 131664
228 Ga0104045_1022004 3300007085 Unclassified 1801
229 Ga0102734_1000077 3300007129 Bacteria 70866
230 Ga0104019_1001214 3300007150 Bacteria 9340
231 Ga0466705_100321 3300042612 Bacteria 2072
232 Ga0466705_277955 3300042612 Bacteria 13235
233 Ga0466733_038690 3300042659 Bacteria 100300
234 Ga0466733_212103 3300042659 Bacteria 23699
235 Ga0123357_10132378 3300009784 Bacteria 3099
236 Ga0123356_10186943 3300010049 Bacteria 2099
237 Ga0123353_10000041 3300010167 Bacteria 137212
238 Ga0123353_10591804 3300010167 Bacteria 1588
239 Ga0123354_10000641 3300010882 Bacteria 36828
240 Ga0123354_10003559 3300010882 Bacteria 21570
241 Ga0123354_10059080 3300010882 Unclassified 5690
242 Ga0466710_417285 3300042613 Bacteria 4061
243 Ga0466715_010035 3300042616 Bacteria 38083
244 Ga0466715_030640 3300042616 Bacteria 2901
245 Ga0466723_332100 3300042618 Bacteria 4735
246 Ga0466723_358056 3300042618 Unclassified 10392
247 Ga0265387_1000548 3300024582 Bacteria 5923
248 Ga0466690_124251 3300042590 Bacteria 8184
249 Ga0466690_378352 3300042590 Bacteria 14565
250 Ga0466692_042688 3300042591 Bacteria 33654
251 Ga0466692_135353 3300042591 Bacteria 2200
252 Ga0466691_089972 3300042593 Bacteria 7881
253 Ga0466699_426866 3300042597 Bacteria 1023
254 Ga0466701_002890 3300042598 Bacteria 12408
255 Ga0466706_014133 3300042599 Bacteria 19194
256 Ga0466706_035124 3300042599 Bacteria 61315
257 Ga0466706_155043 3300042599 Unclassified 1184
258 Ga0466707_047616 3300042601 Bacteria 20965
259 Ga0466714_029794 3300042603 Bacteria 42861
260 Ga0466719_327343 3300042606 Bacteria 2668
261 Ga0466722_209447 3300042609 Bacteria 25046
262 Ga0466722_252821 3300042609 Bacteria 235840
263 Ga0466729_230083 3300042621 Bacteria 2128
264 Ga0466734_142391 3300042623 Bacteria 1059
265 Ga0466735_036328 3300042624 Bacteria 5654
266 Ga0466735_054276 3300042624 Bacteria 2417
267 Ga0466703_046793 3300042636 Bacteria 1604
268 Ga0466703_092516 3300042636 Bacteria 23384
269 Ga0466703_120196 3300042636 Bacteria 8565
270 Ga0466703_410435 3300042636 Bacteria 13859
271 Ga0466704_051910 3300042643 Bacteria 10915
272 Ga0466709_396056 3300042648 Bacteria 40552
273 Ga0466724_13166 3300042649 Bacteria 142311
274 Ga0466727_142679 3300042655 Bacteria 6042
275 2227286349 2225789004 Bacteria 6762
276 2227540478 2225789004 Bacteria 2997
277 IMNBL1DRAFT_c0021247 3300000062 Unclassified 2603
278 JGI24699J35502_11134148 3300002509 Bacteria 37810
279 Ga0068305_10017932 3300005083 Bacteria 13068
280 Ga0102736_1000034 3300007052 Bacteria 55263
281 Ga0103268_1010815 3300007192 Bacteria 1915
282 Ga0123357_10008934 3300009784 Bacteria 12591
283 Ga0123357_10018314 3300009784 Bacteria 9306
284 Ga0123357_10045723 3300009784 Bacteria 5938
285 Ga0123356_10013528 3300010049 Bacteria 7872
286 Ga0160464_105949 3300012805 Bacteria 1357
287 Ga0466705_501169 3300042612 Bacteria 5012
288 Ga0466711_184442 3300042615 Bacteria 5940
289 Ga0466711_323206 3300042615 Bacteria 3194
290 Ga0466711_376448 3300042615 Bacteria 1656
291 Ga0466715_090921 3300042616 Bacteria 11800
292 Ga0466723_141127 3300042618 Bacteria 3873
293 Ga0466728_156095 3300042620 Bacteria 3600
294 Ga0466728_404970 3300042620 Bacteria 46041
295 Ga0466729_116828 3300042621 Bacteria 15216
296 Ga0160440_101175 3300012815 Unclassified 3840
297 Ga0160472_101481 3300012839 Bacteria 6809
298 Ga0160443_100008 3300012848 Bacteria 615500
299 Ga0466690_289464 3300042590 Bacteria 5737
300 Ga0466692_193310 3300042591 Bacteria 49575
301 Ga0466691_012115 3300042593 Bacteria 17649
302 Ga0466701_014588 3300042598 Bacteria 14559
303 Ga0466707_124576 3300042601 Bacteria 23542
304 Ga0466713_064234 3300042602 Bacteria 7519
305 Ga0466714_041819 3300042603 Bacteria 104465
306 Ga0466714_150303 3300042603 Bacteria 28075
307 Ga0466716_116764 3300042605 Bacteria 19942
308 Ga0466719_143659 3300042606 Bacteria 4357
309 Ga0466722_050554 3300042609 Bacteria 3939
310 Ga0466722_096452 3300042609 Bacteria 12880
311 Ga0466722_203823 3300042609 Bacteria 26562
312 Ga0466703_166876 3300042636 Bacteria 14308
313 Ga0466703_359395 3300042636 Bacteria 13580
314 Ga0466704_175561 3300042643 Bacteria 14634
315 Ga0466709_215085 3300042648 Bacteria 10147
316 Ga0466708_069911 3300042652 Bacteria 13157
317 Ga0466725_311188 3300042654 Bacteria 11217
318 Ga0466727_062038 3300042655 Bacteria 3805
319 IMNBL1DRAFT_c0009953 3300000062 Bacteria 4618
320 IMNBL1DRAFT_c0079648 3300000062 Bacteria 921
321 JGI24702J35022_10009022 3300002462 Bacteria 5619
322 JGI24699J35502_11134218 3300002509 Bacteria 66161
323 Ga0068305_10017541 3300005083 Bacteria 7947
324 Ga0103267_1000308 3300007190 Bacteria 17559
325 Ga0466733_080280 3300042659 Bacteria 2282
326 Ga0123357_10018524 3300009784 Bacteria 9259
327 Ga0123357_10021260 3300009784 Bacteria 8687
328 Ga0123357_10133865 3300009784 Bacteria 3074
329 Ga0123357_10448164 3300009784 Bacteria 1123
330 Ga0123353_10211000 3300010167 Bacteria 3046
331 Ga0466711_259192 3300042615 Bacteria 8724
332 Ga0466715_127650 3300042616 Bacteria 20292
333 Ga0466715_234297 3300042616 Bacteria 23273
334 Ga0466715_553479 3300042616 Bacteria 7519
335 Ga0466718_152114 3300042617 Bacteria 1023
336 Ga0466728_242816 3300042620 Bacteria 11602
337 Ga0466729_188785 3300042621 Bacteria 9694
338 Ga0160445_100247 3300012847 Bacteria 38666
339 Ga0466692_136237 3300042591 Bacteria 11500
340 Ga0466693_267335 3300042592 Bacteria 2613
341 Ga0466691_014851 3300042593 Bacteria 13862
342 Ga0466696_140182 3300042596 Bacteria 8552
343 Ga0466696_277790 3300042596 Bacteria 3611
344 Ga0466696_435367 3300042596 Bacteria 3643
345 Ga0466707_058340 3300042601 Bacteria 2510
346 Ga0466707_254121 3300042601 Bacteria 9455
347 Ga0466707_260913 3300042601 Bacteria 1792
348 Ga0466707_297094 3300042601 Bacteria 4597
349 Ga0466707_339007 3300042601 Bacteria 6429
350 Ga0466714_165529 3300042603 Bacteria 3725
351 Ga0466719_025468 3300042606 Bacteria 4125
352 Ga0466719_399603 3300042606 Bacteria 12646
353 Ga0466719_434603 3300042606 Bacteria 3443
354 Ga0466722_187255 3300042609 Bacteria 11075
355 Ga0466729_271082 3300042621 Bacteria 5557
356 Ga0466730_030722 3300042625 Bacteria 1135247
357 Ga0466703_034498 3300042636 Bacteria 2650
358 Ga0466703_177758 3300042636 Bacteria 25094
359 Ga0466724_43312 3300042649 Unclassified 35690
360 Ga0466727_041976 3300042655 Bacteria 33578
361 Ga0466727_044277 3300042655 Bacteria 7771
362 Ga0466727_194949 3300042655 Bacteria 20487
363 2227128034 2225789004 Bacteria 9011
364 2227361377 2225789004 Bacteria 6087
365 JGI24702J35022_10000410 3300002462 Bacteria 25605
366 JGI24702J35022_10031800 3300002462 Bacteria 2826
367 JGI24702J35022_10209830 3300002462 Bacteria 1118
368 Ga0068305_10002699 3300005083 Bacteria 13227

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042603 Ga0466714_165529 Ga0466714_165529_37_699 220
2 3300007085 Ga0104045_1022004 Ga0104045_10220042 223
3 3300042596 Ga0466696_019438 Ga0466696_019438_12_683 223
4 3300042602 Ga0466713_023394 Ga0466713_023394_2155_2883 229
5 3300042655 Ga0466727_041976 Ga0466727_041976_20103_20834 232
6 3300009826 Ga0123355_10143753 Ga0123355_101437532 233
7 3300042623 Ga0466734_143514 Ga0466734_143514_126_827 233
8 3300042602 Ga0466713_124591 Ga0466713_124591_2664_3431 239
9 3300005083 Ga0068305_10017932 Ga0068305_1001793211 240
10 3300000062 IMNBL1DRAFT_c0002818 IMNBL1DRAFT_00028182 241
11 3300000062 IMNBL1DRAFT_c0011574 IMNBL1DRAFT_00115742 241
12 3300042618 Ga0466723_140798 Ga0466723_140798_525_1289 241
13 3300042615 Ga0466711_008524 Ga0466711_008524_257_1027 242
14 2225789004 2227128034 2227523916 243
15 3300009784 Ga0123357_10008934 Ga0123357_100089342 243
16 2225789004 2227465749 2227904166 245
17 3300042619 Ga0466726_032938 Ga0466726_032938_25505_26275 245
18 3300042602 Ga0466713_132210 Ga0466713_132210_32717_33487 246
19 3300000062 IMNBL1DRAFT_c0021247 IMNBL1DRAFT_00212473 247
20 3300042615 Ga0466711_184442 Ga0466711_184442_3593_4339 248
21 3300005083 Ga0068305_10501874 Ga0068305_105018743 250
22 3300042609 Ga0466722_252821 Ga0466722_252821_189977_190735 252
23 3300042624 Ga0466735_036328 Ga0466735_036328_623_1381 252
24 3300042654 Ga0466725_425080 Ga0466725_425080_25140_25898 252
25 3300042600 Ga0466700_271005 Ga0466700_271005_1809_2570 253
26 3300042600 Ga0466700_425448 Ga0466700_425448_177_938 253
27 3300042606 Ga0466719_434603 Ga0466719_434603_1859_2620 253
28 3300042616 Ga0466715_584495 Ga0466715_584495_5178_5939 253
29 3300042618 Ga0466723_137868 Ga0466723_137868_4155_4916 253
30 iso_pr_bacteria 2820759988 2820761866 253
31 3300002462 JGI24702J35022_10001206 JGI24702J35022_100012065 254
32 3300002504 JGI24705J35276_12220383 JGI24705J35276_122203832 254
33 3300002509 JGI24699J35502_11028272 JGI24699J35502_110282722 254
34 3300002509 JGI24699J35502_11134100 JGI24699J35502_1113410026 254
35 3300002509 JGI24699J35502_11134148 JGI24699J35502_111341487 254
36 3300009784 Ga0123357_10001682 Ga0123357_100016824 254
37 3300009784 Ga0123357_10007571 Ga0123357_1000757110 254
38 3300009784 Ga0123357_10014799 Ga0123357_100147994 254
39 3300009784 Ga0123357_10018314 Ga0123357_100183147 254
40 3300009784 Ga0123357_10018524 Ga0123357_100185245 254
41 3300009784 Ga0123357_10021260 Ga0123357_1002126010 254
42 3300009784 Ga0123357_10132378 Ga0123357_101323782 254
43 3300009784 Ga0123357_10133865 Ga0123357_101338652 254
44 3300009784 Ga0123357_10157910 Ga0123357_101579102 254
45 3300009784 Ga0123357_10448164 Ga0123357_104481642 254
46 3300010167 Ga0123353_10170571 Ga0123353_101705713 254
47 3300010882 Ga0123354_10000042 Ga0123354_1000004279 254
48 3300010882 Ga0123354_10000641 Ga0123354_1000064114 254
49 3300010882 Ga0123354_10001055 Ga0123354_100010559 254
50 3300010882 Ga0123354_10202565 Ga0123354_102025651 254
51 3300042592 Ga0466693_267335 Ga0466693_267335_1164_1928 254
52 3300042597 Ga0466699_426866 Ga0466699_426866_141_905 254
53 3300042598 Ga0466701_102428 Ga0466701_102428_41685_42449 254
54 3300042599 Ga0466706_025174 Ga0466706_025174_57553_58317 254
55 3300042601 Ga0466707_339007 Ga0466707_339007_4024_4788 254
56 3300042602 Ga0466713_118304 Ga0466713_118304_4666_5430 254
57 3300042604 Ga0466717_157090 Ga0466717_157090_1388_2152 254
58 3300042619 Ga0466726_081325 Ga0466726_081325_5147_5911 254
59 3300042623 Ga0466734_142391 Ga0466734_142391_197_961 254
60 3300042624 Ga0466735_028619 Ga0466735_028619_208_972 254
61 3300042643 Ga0466704_195822 Ga0466704_195822_720_1484 254
62 3300042649 Ga0466724_28381 Ga0466724_28381_17774_18538 254
63 3300042649 Ga0466724_43696 Ga0466724_43696_333651_334415 254
64 3300042654 Ga0466725_297803 Ga0466725_297803_15784_16548 254
65 3300042654 Ga0466725_311188 Ga0466725_311188_5735_6499 254
66 3300042655 Ga0466727_027589 Ga0466727_027589_1087_1851 254
67 3300042659 Ga0466733_080280 Ga0466733_080280_666_1430 254
68 iso_pr_bacteria 2529292732 2529759654 254
69 iso_pr_bacteria 2847090942 2847093802 254
70 iso_pr_bacteria 2864788197 2864790386 254
71 iso_pr_bacteria 2864822740 2864826101 254
72 iso_pr_bacteria 2864831662 2864834242 254
73 iso_pr_bacteria 2864882932 2864886492 254
74 iso_pr_bacteria 2864923010 2864925199 254
75 iso_pr_bacteria 2864948220 2864950408 254
76 iso_pr_bacteria 2921902974 2921905040 254
77 iso_pr_bacteria 8020009074 8020009305 254
78 iso_pr_bacteria 8114076984 8114078248 254
79 2225789004 2227286349 2227737636 255
80 2225789004 2227344678 2227791039 255
81 3300000062 IMNBL1DRAFT_c0055349 IMNBL1DRAFT_00553492 255
82 3300002464 Meta3P_1002350 Meta3P_10023502 255
83 3300002504 JGI24705J35276_12206071 JGI24705J35276_122060712 255
84 3300005071 Ga0068302_10257965 Ga0068302_102579652 255
85 3300007052 Ga0102736_1000034 Ga0102736_100003448 255
86 3300007068 Ga0103265_1000007 Ga0103265_1000007102 255
87 3300007085 Ga0104045_1076537 Ga0104045_10765372 255
88 3300007129 Ga0102734_1000077 Ga0102734_100007754 255
89 3300007188 Ga0103264_1000022 Ga0103264_10000226 255
90 3300007190 Ga0103267_1000308 Ga0103267_100030815 255
91 3300009784 Ga0123357_10046079 Ga0123357_100460792 255
92 3300042582 Ga0466657_076183 Ga0466657_076183_92_859 255
93 3300042590 Ga0466690_309291 Ga0466690_309291_19848_20615 255
94 3300042597 Ga0466699_052727 Ga0466699_052727_519_1286 255
95 3300042598 Ga0466701_014588 Ga0466701_014588_4208_4975 255
96 3300042598 Ga0466701_032214 Ga0466701_032214_1768_2535 255
97 3300042599 Ga0466706_014133 Ga0466706_014133_12018_12785 255
98 3300042599 Ga0466706_035124 Ga0466706_035124_10785_11552 255
99 3300042602 Ga0466713_009775 Ga0466713_009775_52190_52957 255
100 3300042602 Ga0466713_064234 Ga0466713_064234_1365_2162 255
101 3300042603 Ga0466714_029794 Ga0466714_029794_35434_36201 255
102 3300042603 Ga0466714_041819 Ga0466714_041819_60786_61553 255
103 3300042603 Ga0466714_051789 Ga0466714_051789_617_1384 255
104 3300042603 Ga0466714_140143 Ga0466714_140143_1338_2105 255
105 3300042603 Ga0466714_150303 Ga0466714_150303_18074_18841 255
106 3300042606 Ga0466719_143847 Ga0466719_143847_10707_11474 255
107 3300042609 Ga0466722_216541 Ga0466722_216541_802_1569 255
108 3300042612 Ga0466705_351700 Ga0466705_351700_15508_16275 255
109 3300042616 Ga0466715_090921 Ga0466715_090921_888_1655 255
110 3300042617 Ga0466718_152114 Ga0466718_152114_173_940 255
111 3300042619 Ga0466726_021927 Ga0466726_021927_5525_6292 255
112 3300042648 Ga0466709_396056 Ga0466709_396056_20279_21046 255
113 3300042655 Ga0466727_036553 Ga0466727_036553_1139_1906 255
114 3300042659 Ga0466733_010468 Ga0466733_010468_11833_12600 255
115 iso_pr_bacteria 2820757377 2820759617 255
116 iso_pr_bacteria 2864891731 2864893294 255
117 2225789004 2227361377 2227809293 256
118 3300000062 IMNBL1DRAFT_c0002523 IMNBL1DRAFT_00025236 256
119 3300002509 JGI24699J35502_11134218 JGI24699J35502_1113421859 256
120 3300002834 JGI24696J40584_12941766 JGI24696J40584_129417662 256
121 3300009784 Ga0123357_10045723 Ga0123357_100457233 256
122 3300009784 Ga0123357_10414325 Ga0123357_104143252 256
123 3300010049 Ga0123356_10186943 Ga0123356_101869432 256
124 3300010167 Ga0123353_10000041 Ga0123353_1000004170 256
125 3300010167 Ga0123353_10211000 Ga0123353_102110002 256
126 3300010167 Ga0123353_10591804 Ga0123353_105918041 256
127 3300010882 Ga0123354_10059080 Ga0123354_100590802 256
128 3300010882 Ga0123354_10329157 Ga0123354_103291571 256
129 3300024582 Ga0265387_1000548 Ga0265387_10005483 256
130 3300042590 Ga0466690_124251 Ga0466690_124251_2792_3562 256
131 3300042590 Ga0466690_177182 Ga0466690_177182_11233_12003 256
132 3300042590 Ga0466690_218956 Ga0466690_218956_7830_8600 256
133 3300042590 Ga0466690_223698 Ga0466690_223698_238_1008 256
134 3300042590 Ga0466690_378352 Ga0466690_378352_4397_5167 256
135 3300042590 Ga0466690_403369 Ga0466690_403369_3054_3824 256
136 3300042590 Ga0466690_421784 Ga0466690_421784_352_1122 256
137 3300042591 Ga0466692_042688 Ga0466692_042688_3042_3812 256
138 3300042591 Ga0466692_054187 Ga0466692_054187_1613_2383 256
139 3300042591 Ga0466692_135353 Ga0466692_135353_54_824 256
140 3300042591 Ga0466692_136237 Ga0466692_136237_5836_6606 256
141 3300042593 Ga0466691_014851 Ga0466691_014851_1863_2633 256
142 3300042593 Ga0466691_019050 Ga0466691_019050_24599_25369 256
143 3300042593 Ga0466691_023858 Ga0466691_023858_6399_7169 256
144 3300042593 Ga0466691_089972 Ga0466691_089972_6313_7083 256
145 3300042593 Ga0466691_097455 Ga0466691_097455_12382_13152 256
146 3300042593 Ga0466691_140180 Ga0466691_140180_9752_10522 256
147 3300042596 Ga0466696_010546 Ga0466696_010546_4215_4985 256
148 3300042596 Ga0466696_046481 Ga0466696_046481_935_1705 256
149 3300042596 Ga0466696_078846 Ga0466696_078846_476_1246 256
150 3300042596 Ga0466696_140182 Ga0466696_140182_6109_6879 256
151 3300042596 Ga0466696_166515 Ga0466696_166515_1958_2728 256
152 3300042596 Ga0466696_253210 Ga0466696_253210_155715_156485 256
153 3300042596 Ga0466696_277790 Ga0466696_277790_2500_3270 256
154 3300042596 Ga0466696_331279 Ga0466696_331279_3693_4463 256
155 3300042596 Ga0466696_470316 Ga0466696_470316_2113_2883 256
156 3300042596 Ga0466696_503453 Ga0466696_503453_9433_10203 256
157 3300042598 Ga0466701_002890 Ga0466701_002890_10047_10817 256
158 3300042599 Ga0466706_054207 Ga0466706_054207_65_835 256
159 3300042599 Ga0466706_269132 Ga0466706_269132_230_1000 256
160 3300042599 Ga0466706_275766 Ga0466706_275766_2332_3102 256
161 3300042600 Ga0466700_373334 Ga0466700_373334_22267_23037 256
162 3300042601 Ga0466707_047616 Ga0466707_047616_16125_16895 256
163 3300042601 Ga0466707_056555 Ga0466707_056555_6927_7697 256
164 3300042601 Ga0466707_064540 Ga0466707_064540_2034_2804 256
165 3300042601 Ga0466707_163242 Ga0466707_163242_424_1194 256
166 3300042601 Ga0466707_191904 Ga0466707_191904_4055_4825 256
167 3300042601 Ga0466707_254121 Ga0466707_254121_7208_7978 256
168 3300042601 Ga0466707_260913 Ga0466707_260913_1007_1777 256
169 3300042601 Ga0466707_305252 Ga0466707_305252_269_1039 256
170 3300042602 Ga0466713_034984 Ga0466713_034984_7338_8108 256
171 3300042602 Ga0466713_115233 Ga0466713_115233_17011_17781 256
172 3300042605 Ga0466716_073567 Ga0466716_073567_3318_4088 256
173 3300042605 Ga0466716_116764 Ga0466716_116764_8260_9030 256
174 3300042605 Ga0466716_256212 Ga0466716_256212_2816_3586 256
175 3300042605 Ga0466716_349846 Ga0466716_349846_3734_4504 256
176 3300042606 Ga0466719_053145 Ga0466719_053145_8612_9382 256
177 3300042606 Ga0466719_143659 Ga0466719_143659_3501_4271 256
178 3300042606 Ga0466719_327343 Ga0466719_327343_63_833 256
179 3300042606 Ga0466719_399603 Ga0466719_399603_6382_7152 256
180 3300042609 Ga0466722_066324 Ga0466722_066324_15760_16530 256
181 3300042609 Ga0466722_096452 Ga0466722_096452_9225_9995 256
182 3300042609 Ga0466722_203823 Ga0466722_203823_20712_21482 256
183 3300042609 Ga0466722_209447 Ga0466722_209447_19152_19922 256
184 3300042609 Ga0466722_266222 Ga0466722_266222_5295_6065 256
185 3300042610 Ga0466698_029784 Ga0466698_029784_308_1078 256
186 3300042612 Ga0466705_017856 Ga0466705_017856_4349_5119 256
187 3300042612 Ga0466705_032507 Ga0466705_032507_10685_11455 256
188 3300042612 Ga0466705_100321 Ga0466705_100321_1178_1948 256
189 3300042612 Ga0466705_226040 Ga0466705_226040_1461_2231 256
190 3300042612 Ga0466705_313939 Ga0466705_313939_16106_16876 256
191 3300042612 Ga0466705_329308 Ga0466705_329308_1169_1939 256
192 3300042612 Ga0466705_501169 Ga0466705_501169_2728_3498 256
193 3300042615 Ga0466711_009583 Ga0466711_009583_257_1027 256
194 3300042615 Ga0466711_090299 Ga0466711_090299_20596_21366 256
195 3300042615 Ga0466711_135661 Ga0466711_135661_1137_1907 256
196 3300042615 Ga0466711_243391 Ga0466711_243391_2581_3351 256
197 3300042615 Ga0466711_259192 Ga0466711_259192_6474_7244 256
198 3300042615 Ga0466711_290361 Ga0466711_290361_580_1350 256
199 3300042616 Ga0466715_066146 Ga0466715_066146_4638_5408 256
200 3300042616 Ga0466715_085911 Ga0466715_085911_7106_7876 256
201 3300042616 Ga0466715_087433 Ga0466715_087433_2946_3716 256
202 3300042616 Ga0466715_194192 Ga0466715_194192_3033_3803 256
203 3300042616 Ga0466715_234297 Ga0466715_234297_8451_9221 256
204 3300042616 Ga0466715_426091 Ga0466715_426091_9753_10523 256
205 3300042616 Ga0466715_468054 Ga0466715_468054_14173_14943 256
206 3300042616 Ga0466715_553479 Ga0466715_553479_5691_6461 256
207 3300042618 Ga0466723_250641 Ga0466723_250641_1793_2563 256
208 3300042618 Ga0466723_332100 Ga0466723_332100_1307_2077 256
209 3300042618 Ga0466723_358056 Ga0466723_358056_8432_9202 256
210 3300042619 Ga0466726_328888 Ga0466726_328888_3039_3809 256
211 3300042620 Ga0466728_156095 Ga0466728_156095_957_1727 256
212 3300042620 Ga0466728_200547 Ga0466728_200547_6501_7271 256
213 3300042620 Ga0466728_242816 Ga0466728_242816_9438_10208 256
214 3300042620 Ga0466728_404970 Ga0466728_404970_22926_23696 256
215 3300042621 Ga0466729_065131 Ga0466729_065131_618_1388 256
216 3300042621 Ga0466729_170334 Ga0466729_170334_8511_9281 256
217 3300042621 Ga0466729_230083 Ga0466729_230083_1188_1958 256
218 3300042621 Ga0466729_271082 Ga0466729_271082_1268_2038 256
219 3300042624 Ga0466735_112070 Ga0466735_112070_3145_3915 256
220 3300042624 Ga0466735_118285 Ga0466735_118285_626_1396 256
221 3300042624 Ga0466735_145772 Ga0466735_145772_1724_2494 256
222 3300042624 Ga0466735_224037 Ga0466735_224037_63_833 256
223 3300042636 Ga0466703_008945 Ga0466703_008945_3229_3999 256
224 3300042636 Ga0466703_046793 Ga0466703_046793_522_1292 256
225 3300042636 Ga0466703_092516 Ga0466703_092516_6897_7667 256
226 3300042636 Ga0466703_099136 Ga0466703_099136_419_1189 256
227 3300042636 Ga0466703_166876 Ga0466703_166876_2492_3262 256
228 3300042636 Ga0466703_177758 Ga0466703_177758_20206_20976 256
229 3300042636 Ga0466703_269490 Ga0466703_269490_506_1276 256
230 3300042636 Ga0466703_359395 Ga0466703_359395_9733_10503 256
231 3300042643 Ga0466704_039096 Ga0466704_039096_10169_10939 256
232 3300042643 Ga0466704_151538 Ga0466704_151538_2071_2841 256
233 3300042643 Ga0466704_207722 Ga0466704_207722_7085_7855 256
234 3300042643 Ga0466704_253317 Ga0466704_253317_3617_4387 256
235 3300042643 Ga0466704_268287 Ga0466704_268287_1149_1919 256
236 3300042643 Ga0466704_362592 Ga0466704_362592_4166_4936 256
237 3300042643 Ga0466704_443103 Ga0466704_443103_1966_2736 256
238 3300042648 Ga0466709_215085 Ga0466709_215085_1842_2612 256
239 3300042652 Ga0466708_040867 Ga0466708_040867_20239_21009 256
240 3300042652 Ga0466708_082974 Ga0466708_082974_1585_2355 256
241 3300042652 Ga0466708_298706 Ga0466708_298706_4092_4862 256
242 3300042652 Ga0466708_422671 Ga0466708_422671_8606_9376 256
243 3300042655 Ga0466727_044277 Ga0466727_044277_3294_4064 256
244 3300042655 Ga0466727_062038 Ga0466727_062038_2117_2887 256
245 3300042655 Ga0466727_194949 Ga0466727_194949_13325_14095 256
246 3300042659 Ga0466733_038690 Ga0466733_038690_66026_66796 256
247 3300042659 Ga0466733_156576 Ga0466733_156576_1816_2586 256
248 iso_pr_bacteria 2940199050 2940200444 256
249 iso_pr_bacteria 2940202316 2940205469 256
250 iso_pr_bacteria 2940205530 2940205850 256
251 iso_pr_bacteria 2940209341 2940210529 256
252 iso_pr_bacteria 2940212447 2940212767 256
253 iso_pr_bacteria 2940298504 2940298824 256
254 iso_pr_bacteria 2940302308 2940302628 256
255 iso_pr_bacteria 2940306115 2940306758 256
256 iso_pr_bacteria 2940309933 2940310261 256
257 iso_pr_bacteria 2940313741 2940314071 256
258 iso_pr_bacteria 2940317558 2940317886 256
259 iso_pr_bacteria 2940321370 2940322012 256
260 iso_pr_bacteria 2940325180 2940325256 256
261 iso_pr_bacteria 2940328985 2940329062 256
262 iso_pr_bacteria 2940332795 2940333438 256
263 iso_pr_bacteria 2940346213 2940347355 256
264 iso_pr_bacteria 2967483437 2967484162 256
265 3300000062 IMNBL1DRAFT_c0001371 IMNBL1DRAFT_000137111 257
266 3300000062 IMNBL1DRAFT_c0004497 IMNBL1DRAFT_00044979 257
267 3300000062 IMNBL1DRAFT_c0006017 IMNBL1DRAFT_00060172 257
268 3300002462 JGI24702J35022_10009022 JGI24702J35022_100090223 257
269 3300002462 JGI24702J35022_10025522 JGI24702J35022_100255224 257
270 3300002462 JGI24702J35022_10031800 JGI24702J35022_100318003 257
271 3300002462 JGI24702J35022_10209830 JGI24702J35022_102098301 257
272 3300002462 JGI24702J35022_10265291 JGI24702J35022_102652912 257
273 3300005083 Ga0068305_10017541 Ga0068305_100175416 257
274 3300005083 Ga0068305_10070753 Ga0068305_100707534 257
275 3300005201 Ga0072941_1015407 Ga0072941_10154073 257
276 3300010049 Ga0123356_10024068 Ga0123356_100240682 257
277 3300010167 Ga0123353_10065628 Ga0123353_100656283 257
278 3300042590 Ga0466690_027177 Ga0466690_027177_23989_24762 257
279 3300042590 Ga0466690_289464 Ga0466690_289464_2871_3644 257
280 3300042601 Ga0466707_124576 Ga0466707_124576_14614_15387 257
281 3300042602 Ga0466713_081632 Ga0466713_081632_2710_3483 257
282 3300042603 Ga0466714_054269 Ga0466714_054269_1565_2338 257
283 3300042603 Ga0466714_081810 Ga0466714_081810_1167_1940 257
284 3300042603 Ga0466714_121039 Ga0466714_121039_562_1335 257
285 3300042605 Ga0466716_102860 Ga0466716_102860_1619_2392 257
286 3300042605 Ga0466716_397792 Ga0466716_397792_3967_4740 257
287 3300042609 Ga0466722_050554 Ga0466722_050554_2339_3112 257
288 3300042609 Ga0466722_110099 Ga0466722_110099_2189_2962 257
289 3300042609 Ga0466722_187255 Ga0466722_187255_9092_9865 257
290 3300042612 Ga0466705_277955 Ga0466705_277955_4104_4877 257
291 3300042612 Ga0466705_284900 Ga0466705_284900_1711_2484 257
292 3300042615 Ga0466711_376448 Ga0466711_376448_36_809 257
293 3300042618 Ga0466723_141127 Ga0466723_141127_502_1275 257
294 3300042620 Ga0466728_222413 Ga0466728_222413_4293_5066 257
295 3300042625 Ga0466730_097984 Ga0466730_097984_423736_424509 257
296 3300042636 Ga0466703_120196 Ga0466703_120196_7095_7868 257
297 3300042643 Ga0466704_072664 Ga0466704_072664_4297_5070 257
298 3300042643 Ga0466704_142162 Ga0466704_142162_3222_3995 257
299 3300042643 Ga0466704_536150 Ga0466704_536150_797_1570 257
300 3300042648 Ga0466709_099936 Ga0466709_099936_2574_3347 257
301 3300042648 Ga0466709_183247 Ga0466709_183247_988_1761 257
302 3300042659 Ga0466733_212103 Ga0466733_212103_12734_13507 257
303 2225789004 2227540478 2228061662 258
304 3300002462 JGI24702J35022_10000410 JGI24702J35022_100004103 258
305 3300005083 Ga0068305_10002699 Ga0068305_1000269911 258
306 3300010882 Ga0123354_10003559 Ga0123354_1000355917 258
307 3300010882 Ga0123354_10017632 Ga0123354_100176329 258
308 3300042590 Ga0466690_276223 Ga0466690_276223_15428_16204 258
309 3300042591 Ga0466692_193310 Ga0466692_193310_44006_44782 258
310 3300042593 Ga0466691_128298 Ga0466691_128298_10975_11751 258
311 3300042596 Ga0466696_435367 Ga0466696_435367_2441_3217 258
312 3300042601 Ga0466707_297094 Ga0466707_297094_2057_2833 258
313 3300042603 Ga0466714_009266 Ga0466714_009266_6147_6923 258
314 3300042606 Ga0466719_282293 Ga0466719_282293_1201_1977 258
315 3300042612 Ga0466705_378056 Ga0466705_378056_4914_5690 258
316 3300042613 Ga0466710_417285 Ga0466710_417285_770_1546 258
317 3300042615 Ga0466711_093803 Ga0466711_093803_10752_11528 258
318 3300042615 Ga0466711_097396 Ga0466711_097396_691_1467 258
319 3300042616 Ga0466715_010035 Ga0466715_010035_9491_10267 258
320 3300042616 Ga0466715_030640 Ga0466715_030640_1025_1801 258
321 3300042619 Ga0466726_238478 Ga0466726_238478_3038_3814 258
322 3300042620 Ga0466728_221899 Ga0466728_221899_2876_3652 258
323 3300042621 Ga0466729_188785 Ga0466729_188785_1311_2087 258
324 3300042623 Ga0466734_014088 Ga0466734_014088_502_1278 258
325 3300042636 Ga0466703_007766 Ga0466703_007766_8917_9693 258
326 3300042636 Ga0466703_027299 Ga0466703_027299_1173_1949 258
327 3300042636 Ga0466703_034498 Ga0466703_034498_1674_2450 258
328 3300042636 Ga0466703_221509 Ga0466703_221509_22747_23523 258
329 3300042643 Ga0466704_051910 Ga0466704_051910_4734_5510 258
330 3300042643 Ga0466704_165577 Ga0466704_165577_5950_6726 258
331 3300042643 Ga0466704_288938 Ga0466704_288938_5268_6044 258
332 3300042648 Ga0466709_369756 Ga0466709_369756_5031_5807 258
333 3300042652 Ga0466708_069911 Ga0466708_069911_3913_4689 258
334 3300042655 Ga0466727_210639 Ga0466727_210639_4953_5729 258
335 3300042655 Ga0466727_218918 Ga0466727_218918_2122_2898 258
336 3300000062 IMNBL1DRAFT_c0009953 IMNBL1DRAFT_00099533 259
337 3300000062 IMNBL1DRAFT_c0079648 IMNBL1DRAFT_00796481 259
338 3300005071 Ga0068302_10152344 Ga0068302_101523444 259
339 3300009784 Ga0123357_10125341 Ga0123357_101253412 259
340 3300042598 Ga0466701_033049 Ga0466701_033049_983_1762 259
341 3300042615 Ga0466711_323206 Ga0466711_323206_1345_2124 259
342 3300042619 Ga0466726_294712 Ga0466726_294712_1422_2201 259
343 3300042655 Ga0466727_141033 Ga0466727_141033_3606_4385 259
344 3300042655 Ga0466727_142679 Ga0466727_142679_37_816 259
345 3300042590 Ga0466690_035035 Ga0466690_035035_3713_4495 260
346 3300042594 Ga0466694_066036 Ga0466694_066036_585_1367 260
347 3300042599 Ga0466706_071532 Ga0466706_071532_1121_1903 260
348 3300042599 Ga0466706_154787 Ga0466706_154787_76_858 260
349 3300042599 Ga0466706_155043 Ga0466706_155043_76_858 260
350 3300042606 Ga0466719_025468 Ga0466719_025468_1795_2577 260
351 3300042606 Ga0466719_303945 Ga0466719_303945_3309_4091 260
352 3300042636 Ga0466703_410435 Ga0466703_410435_6654_7436 260
353 3300042636 Ga0466703_421965 Ga0466703_421965_2557_3339 260
354 3300007143 Ga0104048_1020014 Ga0104048_10200142 261
355 3300042603 Ga0466714_163273 Ga0466714_163273_1157_1942 261
356 3300042624 Ga0466735_066144 Ga0466735_066144_12_797 261
357 3300042624 Ga0466735_112809 Ga0466735_112809_560_1345 261
358 3300042591 Ga0466692_092133 Ga0466692_092133_6094_6882 262
359 3300042592 Ga0466693_226172 Ga0466693_226172_117_905 262
360 3300042599 Ga0466706_093516 Ga0466706_093516_3180_3968 262
361 3300042615 Ga0466711_240969 Ga0466711_240969_5305_6093 262
362 3300042616 Ga0466715_127650 Ga0466715_127650_16528_17316 262
363 3300042609 Ga0466722_084826 Ga0466722_084826_1232_2023 263
364 3300042643 Ga0466704_175561 Ga0466704_175561_11632_12423 263
365 3300042659 Ga0466733_026093 Ga0466733_026093_404_1198 264
366 3300042601 Ga0466707_301453 Ga0466707_301453_2126_2923 265
367 3300042616 Ga0466715_417726 Ga0466715_417726_853_1650 265
368 iso_pr_bacteria 3000153175 3000154133 265
369 3300042602 Ga0466713_012145 Ga0466713_012145_18158_18958 266
370 3300042624 Ga0466735_054276 Ga0466735_054276_977_1777 266
371 3300003131 Ga0052165_100011 Ga0052165_1000118 267
372 3300010049 Ga0123356_10013528 Ga0123356_100135285 267
373 iso_pr_bacteria 2998907766 2998908313 267
374 iso_pr_bacteria 3000336795 3000337454 267
375 3300042601 Ga0466707_058340 Ga0466707_058340_924_1730 268
376 3300042602 Ga0466713_099716 Ga0466713_099716_11360_12166 268
377 3300042620 Ga0466728_312262 Ga0466728_312262_302_1111 269
378 3300042593 Ga0466691_012115 Ga0466691_012115_9342_10154 270
379 3300042618 Ga0466723_225795 Ga0466723_225795_9715_10530 271
380 iso_pr_bacteria 2864836148 2864840231 271
381 iso_pr_bacteria 2687453786 2690170516 272
382 3300042621 Ga0466729_116828 Ga0466729_116828_2053_2880 275
383 3300007153 Ga0104050_1001574 Ga0104050_10015744 285
384 3300012805 Ga0160464_105949 Ga0160464_1059492 287
385 3300042598 Ga0466701_096044 Ga0466701_096044_140586_141539 287
386 3300042625 Ga0466730_030722 Ga0466730_030722_91979_92932 292
387 3300012845 Ga0160460_100032 Ga0160460_10003258 294
388 3300007143 Ga0104048_1022272 Ga0104048_10222726 298
389 3300012839 Ga0160472_101481 Ga0160472_1014812 298
390 3300012825 Ga0160441_100889 Ga0160441_1008894 301
391 3300042649 Ga0466724_13166 Ga0466724_13166_119238_120191 301
392 3300005316 Ga0074302_1136903 Ga0074302_11369032 302
393 3300012847 Ga0160445_100247 Ga0160445_10024739 303
394 3300042649 Ga0466724_18164 Ga0466724_18164_3763_4716 304
395 3300012813 Ga0160470_100832 Ga0160470_1008324 309
396 3300012815 Ga0160440_101175 Ga0160440_1011753 309
397 3300012857 Ga0160435_1000007 Ga0160435_1000007146 309
398 3300042649 Ga0466724_43312 Ga0466724_43312_5166_6122 310
399 3300007150 Ga0104019_1001214 Ga0104019_10012144 313
400 3300007192 Ga0103268_1010815 Ga0103268_10108152 313
401 3300012850 Ga0160434_100083 Ga0160434_10008334 316
402 iso_pr_bacteria 2873776654 2873781432 317
403 iso_pr_bacteria 2590828803 2592928677 321
404 3300012837 Ga0160455_100168 Ga0160455_1001685 324
405 3300012846 Ga0160433_100246 Ga0160433_10024629 324
406 3300012848 Ga0160443_100008 Ga0160443_100008533 330

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20600 ExoX-like_C Exodeoxyribonuclease X-like C-terminal 221 245 0.96
PF00929 RNase_T Exonuclease 11 165 0.95

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.