Protein Family IF03759

Metagenome Isolate
310 Members
161 Samples
75 Scaffolds
539.05 Avg Length

🧬 Representative Sequence

ID
3300012829|Ga0160467_102682|Ga0160467_1026822
Length
568 aa
Sequence
MPLLRVVLKNRYFRPSRQQRYPEEITAAHILGDSMERTTVKPLLLALALASTTPFAQAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNRLTQFKRGGTEIEPGLATSWDVSTDGLTYTFHLRDGVKFHTTDYFTPTRDFNADDVLFTFKRLLDPENAFRKAYPAESPYFTDMGLNTTIKSVDKIDDHTVRFNLNNVDAAFVQNLAMSFASVQSAEYAAQLLKDGKAADLNQKPVGTGPFVFKRYQKDSQIRYTANRSYWKPEDVKLDNLVFSITPDAAVRLQKLKAGECQVSGYPRPADIEVMEKDPNLRVLKQAGFNLGFLAYNVTHPPLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAQNALPPAQWSYDPGIKDAPHDPAKAKALLKEAGVAPGTTINLWAMTVQRASNPNARMSAQMIQQDWEKVGIKANIVSYEWGEYIKRAKNGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDKLVQQAKVSTDRQQRINLYQQAQQILKQQVPITPIANSTVFQPLRKEVTDFKISPFGLTPFYGVGINK*

📊 Sample Types

Isolate 68.4%
Metagenome 31.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 53.3%
Elmidae 8.7%
Culicidae 6.7%
Curculionidae 6.7%
Armadillidiidae 5.3%
Unclassified 4.7%
Formicidae 4.7%
Termitidae 2.0%
Drosophilidae 1.3%
Berytidae 1.3%
Largidae 1.3%
Siricidae 0.7%
Thripidae 0.7%
Tenebrionidae 0.7%
Trigoniulidae 0.7%
Rhinotermitidae 0.7%
Alydidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 278
Eukaryota 0
Viruses 0
Unclassified 32

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
2 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
3 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
4 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
5 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
8 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
9 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
10 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
11 8023757577 Caballeronia peredens LP006 Isolate Coreidae
12 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
13 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
14 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
15 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
16 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
17 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
18 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
19 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
20 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
21 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
22 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
23 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
24 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
27 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
28 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
29 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
30 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
31 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
32 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
35 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
36 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
37 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
38 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
39 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
40 8102117041 Caballeronia sp. INML3 Isolate Coreidae
41 8102131453 Caballeronia sp. INML5 Isolate Coreidae
42 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
43 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
44 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
45 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
46 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
47 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
48 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
49 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
50 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
51 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
52 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
53 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
54 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
55 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
56 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
57 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
58 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
59 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
60 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
61 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
62 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
63 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
64 8052469819 Pseudomonas putida DZ-F23 Isolate
65 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
66 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
67 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
68 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
69 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
70 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
71 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
72 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
73 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
74 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
75 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
76 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
77 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
78 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
79 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
80 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
81 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
82 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
83 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
84 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
85 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
86 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
87 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
88 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
89 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
90 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
91 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
92 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
93 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
94 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
95 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
96 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
97 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
98 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
99 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
100 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
101 8102102351 Caballeronia sp. INML1 Isolate Coreidae
102 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
103 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
104 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
105 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
106 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
107 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
108 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
109 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
110 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
111 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
112 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
113 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
114 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
115 637000219 Pseudomonas entomophila L48 Isolate Unclassified
116 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
117 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
118 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
119 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
120 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
121 8102124461 Caballeronia sp. INML3B Isolate Coreidae
122 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
123 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
124 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
125 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
126 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
127 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
128 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
129 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
130 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
131 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
132 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
133 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
134 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
135 8069748016 Caballeronia sp. LP003 Isolate Coreidae
136 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
137 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
138 8102109360 Caballeronia sp. INML2 Isolate Coreidae
139 8102145433 Caballeronia sp. LP006 Isolate Coreidae
140 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
141 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
142 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
143 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
144 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
145 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
146 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
147 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
148 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
149 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
150 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
151 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
152 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
153 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
154 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
155 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
156 8035422605 Pseudomonas monteilii CY06 Isolate
157 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
158 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
159 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
160 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
161 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160444_100779 3300012841 Unclassified 9357
2 Ga0160433_100085 3300012846 Bacteria 96359
3 Ga0160433_102743 3300012846 Bacteria 3565
4 Ga0160447_101587 3300012849 Bacteria 8675
5 Ga0160448_100841 3300012854 Bacteria 10358
6 Ga0160448_105623 3300012854 Bacteria 3254
7 Ga0160436_1009300 3300012861 Unclassified 2177
8 Ga0466701_011800 3300042598 Bacteria 98335
9 DPO_contig00839 2032320009 Unclassified 13277
10 SPBB_contig11539 2044078006 Bacteria 54533
11 CVPL005W_1001282 3300002934 Unclassified 13648
12 Ga0105005_1025589 3300007505 Bacteria 5581
13 Ga0466724_33450 3300042649 Bacteria 14449
14 Ga0160471_100732 3300012812 Unclassified 8022
15 Ga0562378_0015 3300056814 Bacteria 945537
16 Ga0160441_100788 3300012825 Unclassified 16552
17 Ga0160447_101097 3300012849 Unclassified 11006
18 Ga0160457_1001475 3300012858 Bacteria 6408
19 DPOL_contig06126 2035918003 Bacteria 42797
20 CVPL005L_10001161 3300002938 Bacteria 29805
21 Ga0102734_1010455 3300007129 Bacteria 4282
22 Ga0104042_1001193 3300007130 Bacteria 2336
23 Ga0103264_1000156 3300007188 Bacteria 41202
24 Ga0160432_100467 3300012818 Bacteria 26343
25 Ga0160469_102555 3300012824 Unclassified 3288
26 Ga0160467_102682 3300012829 Bacteria 3656
27 Meta3P_1001457 3300002464 Unclassified 23408
28 CVPL010W_10009297 3300002931 Bacteria 8972
29 CVPL005W_1000162 3300002934 Bacteria 29037
30 Ga0102734_1003829 3300007129 Bacteria 3399
31 Ga0104147_1020297 3300007224 Bacteria 8430
32 Ga0466724_47254 3300042649 Bacteria 18795
33 Ga0160466_100249 3300012809 Bacteria 36542
34 Ga0160466_100346 3300012809 Unclassified 27845
35 Ga0466701_032540 3300042598 Bacteria 10018
36 Ga0466713_014808 3300042602 Bacteria 349625
37 Ga0160431_100483 3300012828 Unclassified 16446
38 Ga0160433_100231 3300012846 Bacteria 40955
39 Ga0160443_101426 3300012848 Unclassified 8124
40 Ga0160430_101164 3300012852 Bacteria 10563
41 SPBB_contig09103 2044078006 Bacteria 56705
42 SWWA_contig13739__length_9942___numreads_562 2100351016 Bacteria 9942
43 CVPL005W_1000080 3300002934 Bacteria 37325
44 Ga0123357_10000050 3300009784 Bacteria 93540
45 Ga0160470_100228 3300012813 Unclassified 44164
46 Ga0160459_101617 3300012831 Unclassified 4573
47 FGTW_contig29636 2065487013 Bacteria 7011
48 CVPL010W_10001139 3300002931 Bacteria 30625
49 Ga0160466_101089 3300012809 Unclassified 8852
50 Ga0466701_096949 3300042598 Bacteria 149718
51 Ga0160467_102301 3300012829 Unclassified 4479
52 Ga0160460_100788 3300012845 Unclassified 14503
53 Ga0160445_100365 3300012847 Bacteria 25559
54 DPO_contig08621 2032320009 Bacteria 19466
55 SWWA_contig16970__length_4489___numreads_75 2100351016 Unclassified 4489
56 Ga0063521_1000044 3300003973 Bacteria 108331
57 Ga0103264_1000198 3300007188 Bacteria 49831
58 Ga0103264_1001398 3300007188 Bacteria 10609
59 Ga0103268_1003474 3300007192 Bacteria 3302
60 Ga0105005_1024496 3300007505 Unclassified 4879
61 Ga0466724_22286 3300042649 Bacteria 91157
62 Ga0160440_100220 3300012815 Unclassified 42429
63 Ga0160455_102486 3300012837 Bacteria 3764
64 Ga0160447_102708 3300012849 Unclassified 6051
65 Ga0160436_1007874 3300012861 Unclassified 2417
66 DPOL_contig19706 2035918003 Bacteria 59159
67 Ga0105005_1032673 3300007505 Bacteria 9235
68 Ga0160454_100705 3300012798 Unclassified 7275
69 Ga0160465_100583 3300012803 Bacteria 15678
70 Ga0466701_026230 3300042598 Bacteria 150849
71 Ga0160434_101507 3300012850 Unclassified 4327
72 Ga0160448_100023 3300012854 Bacteria 202907
73 Ga0255572_1000006 3300026175 Bacteria 236537
74 SPBB_contig11367 2044078006 Unclassified 3442
75 Ga0466701_041263 3300042598 Bacteria 158002

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012846 Ga0160433_102743 Ga0160433_1027434 488
2 2035918003 DPOL_contig06126 DPOLB_238160 511
3 2032320009 DPO_contig00839 DPOB_384390 514
4 2032320009 DPO_contig08621 DPOB_320470 514
5 3300002464 Meta3P_1001457 Meta3P_100145712 514
6 2044078006 SPBB_contig11367 SPBB_180090 518
7 iso_pr_bacteria 2597489944 2598061550 518
8 2100351016 SWWA_contig16970__length_4489___numreads_75 SWWA_03082340 519
9 iso_pr_bacteria 2864968865 2864971106 519
10 iso_pr_bacteria 2864808494 2864809883 525
11 iso_pr_bacteria 2864812326 2864813715 525
12 iso_pr_bacteria 2864808494 2864809890 526
13 iso_pr_bacteria 2864812326 2864813722 526
14 2032320009 DPO_contig00839 DPOB_384380 527
15 2044078006 SPBB_contig11539 SPBB_380010 527
16 iso_pr_bacteria 2864745180 2864746540 527
17 iso_pr_bacteria 2864853652 2864854559 527
18 3300042598 Ga0466701_011800 Ga0466701_011800_88283_89872 529
19 iso_pr_bacteria 2864808494 2864809889 529
20 iso_pr_bacteria 2864812326 2864813721 529
21 3300042598 Ga0466701_041263 Ga0466701_041263_7290_8882 530
22 3300042649 Ga0466724_22286 Ga0466724_22286_40847_42439 530
23 3300042649 Ga0466724_33450 Ga0466724_33450_9012_10604 530
24 iso_pr_bacteria 2990166910 2990169640 530
25 iso_pr_bacteria 3007478678 3007481729 530
26 iso_pr_bacteria 637000219 638000142 530
27 iso_pr_bacteria 8035422605 8035425978 530
28 iso_pr_bacteria 8052469819 8052471484 530
29 3300012803 Ga0160465_100583 Ga0160465_1005832 531
30 3300012825 Ga0160441_100788 Ga0160441_10078814 531
31 3300012828 Ga0160431_100483 Ga0160431_10048314 531
32 3300012846 Ga0160433_100085 Ga0160433_1000855 531
33 iso_pr_bacteria 2864859030 2864860335 531
34 iso_pr_bacteria 2864914039 2864915644 531
35 iso_pr_bacteria 2864988360 2864992320 531
36 2100351016 SWWA_contig13739__length_9942___numreads_562 SWWA_02263210 532
37 3300042598 Ga0466701_032540 Ga0466701_032540_5787_7385 532
38 iso_pr_bacteria 2820123897 2820126079 532
39 iso_pr_bacteria 2864739902 2864742100 532
40 iso_pr_bacteria 2864751016 2864754930 532
41 iso_pr_bacteria 2864751016 2864754931 532
42 iso_pr_bacteria 2864859030 2864859039 532
43 iso_pr_bacteria 2864914039 2864914048 532
44 iso_pr_bacteria 2864988360 2864988369 532
45 iso_pr_bacteria 2997878596 2997884456 532
46 2032320009 DPO_contig08621 DPOB_320490 533
47 2035918003 DPOL_contig19706 DPOLB_2165610 533
48 2044078006 SPBB_contig09103 SPBB_592310 533
49 2044078006 SPBB_contig09103 SPBB_592330 533
50 2065487013 FGTW_contig29636 FGTW_02598180 533
51 3300009784 Ga0123357_10000050 Ga0123357_1000005044 533
52 3300012809 Ga0160466_100249 Ga0160466_1002495 533
53 3300012824 Ga0160469_102555 Ga0160469_1025552 533
54 3300012829 Ga0160467_102301 Ga0160467_1023012 533
55 3300012858 Ga0160457_1001475 Ga0160457_10014752 533
56 3300026175 Ga0255572_1000006 Ga0255572_1000006112 533
57 3300026175 Ga0255572_1000006 Ga0255572_1000006113 533
58 iso_pr_bacteria 2519899622 2520390964 533
59 iso_pr_bacteria 2864739902 2864742098 533
60 iso_pr_bacteria 2864745180 2864746539 533
61 iso_pr_bacteria 2864847319 2864849401 533
62 iso_pr_bacteria 2864847319 2864849435 533
63 iso_pr_bacteria 2864853652 2864854560 533
64 iso_pr_bacteria 2864903489 2864906604 533
65 iso_pr_bacteria 2990166910 2990170204 533
66 iso_pr_bacteria 2997878596 2997884454 533
67 iso_pr_bacteria 8011357093 8011359191 533
68 iso_pr_bacteria 8024025509 8024030691 533
69 iso_pr_bacteria 8025723035 8025726834 533
70 iso_pr_bacteria 8035321120 8035326504 533
71 iso_pr_bacteria 8035321120 8035326506 533
72 iso_pr_bacteria 8035326735 8035331570 533
73 iso_pr_bacteria 8035326735 8035331572 533
74 iso_pr_bacteria 8102181083 8102184882 533
75 2032320009 DPO_contig00839 DPOB_384370 534
76 2035918003 DPOL_contig19706 DPOLB_2165570 534
77 2044078006 SPBB_contig11539 SPBB_380020 534
78 3300012798 Ga0160454_100705 Ga0160454_1007054 534
79 3300012813 Ga0160470_100228 Ga0160470_10022818 534
80 3300012813 Ga0160470_100228 Ga0160470_10022820 534
81 3300012837 Ga0160455_102486 Ga0160455_1024861 534
82 3300012845 Ga0160460_100788 Ga0160460_1007888 534
83 3300012849 Ga0160447_101587 Ga0160447_1015872 534
84 3300012850 Ga0160434_101507 Ga0160434_1015073 534
85 3300012861 Ga0160436_1009300 Ga0160436_10093001 534
86 iso_pr_bacteria 2519899622 2520390966 534
87 iso_pr_bacteria 2864745180 2864746541 534
88 iso_pr_bacteria 2864853652 2864854558 534
89 iso_pr_bacteria 3007473699 3007478541 534
90 iso_pr_bacteria 8024014383 8024019096 534
91 iso_pr_bacteria 8024044713 8024049141 534
92 iso_pr_bacteria 8102020860 8102026632 534
93 iso_pr_bacteria 8102081745 8102086628 534
94 3300002464 Meta3P_1001457 Meta3P_100145714 535
95 3300002931 CVPL010W_10001139 CVPL010W_100011394 535
96 3300002931 CVPL010W_10009297 CVPL010W_1000929711 535
97 3300002934 CVPL005W_1001282 CVPL005W_100128214 535
98 3300002938 CVPL005L_10001161 CVPL005L_100011614 535
99 iso_pr_bacteria 2778261153 2779044734 535
100 iso_pr_bacteria 2864926767 2864929119 535
101 iso_pr_bacteria 8025650824 8025655363 535
102 iso_pr_bacteria 8025658853 8025663153 535
103 iso_pr_bacteria 8025671076 8025676461 535
104 iso_pr_bacteria 8025685901 8025690755 535
105 iso_pr_bacteria 8025694439 8025698935 535
106 iso_pr_bacteria 8025716094 8025719875 535
107 iso_pr_bacteria 8025740903 8025744990 535
108 iso_pr_bacteria 8069763219 8069767306 535
109 iso_pr_bacteria 8078130113 8078135220 535
110 iso_pr_bacteria 8101981714 8101986692 535
111 iso_pr_bacteria 8101994502 8101999641 535
112 iso_pr_bacteria 8102026984 8102032110 535
113 iso_pr_bacteria 8102033761 8102039078 535
114 iso_pr_bacteria 8102131453 8102136129 535
115 iso_pr_bacteria 8102186987 8102190766 535
116 iso_pr_bacteria 8102208438 8102212977 535
117 iso_pr_bacteria 8102216467 8102220963 535
118 iso_pr_bacteria 8102223607 8102228992 535
119 iso_pr_bacteria 8102230706 8102235560 535
120 iso_pr_bacteria 8102239244 8102243543 535
121 iso_pr_bacteria 8102251710 8102256010 535
122 iso_pr_bacteria 8102264549 8102269444 535
123 iso_pr_bacteria 8102271933 8102276835 535
124 iso_pr_bacteria 8102279326 8102284329 535
125 iso_pr_bacteria 8102286609 8102291718 535
126 3300007129 Ga0102734_1010455 Ga0102734_10104555 536
127 3300007192 Ga0103268_1003474 Ga0103268_10034744 536
128 3300012841 Ga0160444_100779 Ga0160444_1007791 536
129 3300012846 Ga0160433_100231 Ga0160433_10023142 536
130 3300012847 Ga0160445_100365 Ga0160445_1003653 536
131 3300012848 Ga0160443_101426 Ga0160443_1014269 536
132 3300012849 Ga0160447_101097 Ga0160447_1010977 536
133 3300012849 Ga0160447_102708 Ga0160447_1027082 536
134 iso_pr_bacteria 2871760914 2871765396 536
135 3300003973 Ga0063521_1000044 Ga0063521_100004413 537
136 3300007188 Ga0103264_1001398 Ga0103264_10013984 537
137 3300007224 Ga0104147_1020297 Ga0104147_10202976 537
138 3300012854 Ga0160448_100023 Ga0160448_100023131 537
139 3300042602 Ga0466713_014808 Ga0466713_014808_331474_333087 537
140 iso_pr_bacteria 2864903489 2864906608 537
141 3300002934 CVPL005W_1000080 CVPL005W_100008027 538
142 3300042598 Ga0466701_096949 Ga0466701_096949_28349_30010 538
143 3300002934 CVPL005W_1000162 CVPL005W_100016211 539
144 3300007188 Ga0103264_1000198 Ga0103264_100019817 539
145 iso_pr_bacteria 8025701579 8025702211 539
146 iso_pr_bacteria 8025728939 8025733694 539
147 iso_pr_bacteria 8102174626 8102179381 539
148 iso_pr_bacteria 8102201977 8102202609 539
149 3300007129 Ga0102734_1003829 Ga0102734_10038293 540
150 3300007188 Ga0103264_1000156 Ga0103264_100015612 540
151 iso_pr_bacteria 2864739902 2864742099 540
152 2044078006 SPBB_contig09103 SPBB_592320 541
153 3300007505 Ga0105005_1025589 Ga0105005_10255892 541
154 3300012849 Ga0160447_101587 Ga0160447_1015875 541
155 3300042598 Ga0466701_011800 Ga0466701_011800_86393_88018 541
156 3300042598 Ga0466701_041263 Ga0466701_041263_9046_10671 541
157 3300042649 Ga0466724_22286 Ga0466724_22286_38998_40623 541
158 3300042649 Ga0466724_33450 Ga0466724_33450_7233_8858 541
159 3300042649 Ga0466724_47254 Ga0466724_47254_11178_12803 541
160 iso_pr_bacteria 3007478678 3007481730 541
161 iso_pr_bacteria 637000219 638000143 541
162 iso_pr_bacteria 8011329375 8011335216 541
163 iso_pr_bacteria 8035321120 8035326505 541
164 iso_pr_bacteria 8035326735 8035331571 541
165 iso_pr_bacteria 8035422605 8035425979 541
166 iso_pr_bacteria 8052469819 8052471485 541
167 2032320009 DPO_contig08621 DPOB_320480 542
168 3300007130 Ga0104042_1001193 Ga0104042_10011931 542
169 3300012845 Ga0160460_100788 Ga0160460_1007887 542
170 3300012846 Ga0160433_100085 Ga0160433_1000854 542
171 3300042598 Ga0466701_026230 Ga0466701_026230_99792_101420 542
172 iso_pr_bacteria 2519899622 2520390965 542
173 iso_pr_bacteria 2997878596 2997884455 542
174 iso_pr_bacteria 3007473699 3007478540 542
175 3300002464 Meta3P_1001457 Meta3P_100145713 543
176 iso_pr_bacteria 2597489944 2598058738 543
177 iso_pr_bacteria 3003869270 3003872474 543
178 iso_pr_bacteria 3003878002 3003881507 543
179 iso_pr_bacteria 8023724303 8023726784 543
180 iso_pr_bacteria 8023724303 8023727906 543
181 iso_pr_bacteria 8023747282 8023751023 543
182 iso_pr_bacteria 8023752828 8023756655 543
183 iso_pr_bacteria 8023757577 8023760058 543
184 iso_pr_bacteria 8023757577 8023761180 543
185 iso_pr_bacteria 8023764196 8023767887 543
186 iso_pr_bacteria 8023764196 8023769853 543
187 iso_pr_bacteria 8024001094 8024003736 543
188 iso_pr_bacteria 8024001094 8024004641 543
189 iso_pr_bacteria 8024014383 8024016909 543
190 iso_pr_bacteria 8024025509 8024025673 543
191 iso_pr_bacteria 8024044713 8024047348 543
192 iso_pr_bacteria 8025666332 8025668995 543
193 iso_pr_bacteria 8025685901 8025685993 543
194 iso_pr_bacteria 8025701579 8025706154 543
195 iso_pr_bacteria 8025708040 8025710877 543
196 iso_pr_bacteria 8025723035 8025725528 543
197 iso_pr_bacteria 8025728939 8025731857 543
198 iso_pr_bacteria 8025735396 8025736353 543
199 iso_pr_bacteria 8025747911 8025750683 543
200 iso_pr_bacteria 8025747911 8025753488 543
201 iso_pr_bacteria 8025756023 8025758795 543
202 iso_pr_bacteria 8025756023 8025761602 543
203 iso_pr_bacteria 8069755105 8069757877 543
204 iso_pr_bacteria 8069755105 8069760682 543
205 iso_pr_bacteria 8069770227 8069773968 543
206 iso_pr_bacteria 8069775773 8069779600 543
207 iso_pr_bacteria 8078130113 8078132778 543
208 iso_pr_bacteria 8102014801 8102017508 543
209 iso_pr_bacteria 8102020860 8102020945 543
210 iso_pr_bacteria 8102041249 8102043857 543
211 iso_pr_bacteria 8102041249 8102044683 543
212 iso_pr_bacteria 8102054868 8102057479 543
213 iso_pr_bacteria 8102060671 8102063506 543
214 iso_pr_bacteria 8102060671 8102064418 543
215 iso_pr_bacteria 8102074813 8102077541 543
216 iso_pr_bacteria 8102074813 8102078534 543
217 iso_pr_bacteria 8102081745 8102084458 543
218 iso_pr_bacteria 8102087471 8102090095 543
219 iso_pr_bacteria 8102087471 8102090822 543
220 iso_pr_bacteria 8102094248 8102094334 543
221 iso_pr_bacteria 8102102351 8102104999 543
222 iso_pr_bacteria 8102109360 8102112071 543
223 iso_pr_bacteria 8102117041 8102119690 543
224 iso_pr_bacteria 8102124461 8102127303 543
225 iso_pr_bacteria 8102138357 8102141039 543
226 iso_pr_bacteria 8102145433 8102147914 543
227 iso_pr_bacteria 8102145433 8102149036 543
228 iso_pr_bacteria 8102152052 8102155743 543
229 iso_pr_bacteria 8102152052 8102157709 543
230 iso_pr_bacteria 8102161003 8102163589 543
231 iso_pr_bacteria 8102161003 8102167585 543
232 iso_pr_bacteria 8102169119 8102170076 543
233 iso_pr_bacteria 8102174626 8102177544 543
234 iso_pr_bacteria 8102181083 8102183576 543
235 iso_pr_bacteria 8102193924 8102196759 543
236 iso_pr_bacteria 8102201977 8102206552 543
237 iso_pr_bacteria 8102230706 8102230798 543
238 iso_pr_bacteria 8102246966 8102249629 543
239 3300012812 Ga0160471_100732 Ga0160471_1007325 544
240 3300012815 Ga0160440_100220 Ga0160440_10022010 544
241 3300012831 Ga0160459_101617 Ga0160459_1016172 544
242 iso_pr_bacteria 2841821538 2841822950 544
243 iso_pr_bacteria 8024037630 8024040351 544
244 iso_pr_bacteria 8025716094 8025716178 544
245 iso_pr_bacteria 8025740903 8025743546 544
246 iso_pr_bacteria 8069748016 8069749264 544
247 iso_pr_bacteria 8069763219 8069765862 544
248 iso_pr_bacteria 8101951471 8101954157 544
249 iso_pr_bacteria 8101960468 8101963155 544
250 iso_pr_bacteria 8101967387 8101970069 544
251 iso_pr_bacteria 8101974301 8101976992 544
252 iso_pr_bacteria 8101981714 8101984378 544
253 iso_pr_bacteria 8101988189 8101990911 544
254 iso_pr_bacteria 8101994502 8101994585 544
255 iso_pr_bacteria 8102001125 8102003649 544
256 iso_pr_bacteria 8102007614 8102010328 544
257 iso_pr_bacteria 8102026984 8102029762 544
258 iso_pr_bacteria 8102033761 8102033778 544
259 iso_pr_bacteria 8102047609 8102050492 544
260 iso_pr_bacteria 8102067727 8102070418 544
261 iso_pr_bacteria 8102131453 8102133581 544
262 iso_pr_bacteria 8102186987 8102187071 544
263 iso_pr_bacteria 8102264549 8102267312 544
264 iso_pr_bacteria 8102271933 8102274797 544
265 iso_pr_bacteria 8102279326 8102282666 544
266 iso_pr_bacteria 8102286609 8102289563 544
267 iso_pr_bacteria 8102312426 8102314923 544
268 iso_pr_bacteria 8024019580 8024019782 546
269 iso_pr_bacteria 8024019580 8024024293 546
270 iso_pr_bacteria 2571042003 2571062365 547
271 iso_pr_bacteria 3003878002 3003881508 547
272 iso_pr_bacteria 8023747282 8023749781 548
273 iso_pr_bacteria 8025735396 8025739345 548
274 iso_pr_bacteria 8069770227 8069772726 548
275 iso_pr_bacteria 8102169119 8102173068 548
276 2065487013 FGTW_contig29636 FGTW_02598190 549
277 2035918003 DPOL_contig19706 DPOLB_2165590 550
278 3300007505 Ga0105005_1024496 Ga0105005_10244963 550
279 3300012809 Ga0160466_100346 Ga0160466_1003465 550
280 3300012813 Ga0160470_100228 Ga0160470_10022819 550
281 3300012818 Ga0160432_100467 Ga0160432_1004676 550
282 3300012849 Ga0160447_101587 Ga0160447_1015874 550
283 3300012854 Ga0160448_105623 Ga0160448_1056232 550
284 3300012861 Ga0160436_1007874 Ga0160436_10078741 550
285 iso_pr_bacteria 2571042003 2571062364 550
286 iso_pr_bacteria 8025708040 8025712293 551
287 iso_pr_bacteria 8101988189 8101993151 551
288 iso_pr_bacteria 8102094248 8102099474 551
289 iso_pr_bacteria 8102102351 8102107657 551
290 iso_pr_bacteria 8102109360 8102114515 551
291 iso_pr_bacteria 8102117041 8102122269 551
292 iso_pr_bacteria 8102124461 8102129715 551
293 iso_pr_bacteria 8102138357 8102143305 551
294 iso_pr_bacteria 8102193924 8102198175 551
295 iso_pr_bacteria 8025650824 8025653749 553
296 iso_pr_bacteria 8025658853 8025658950 553
297 iso_pr_bacteria 8025671076 8025673762 553
298 iso_pr_bacteria 8025678175 8025680698 553
299 iso_pr_bacteria 8025694439 8025697402 553
300 iso_pr_bacteria 8102208438 8102211363 553
301 iso_pr_bacteria 8102216467 8102219430 553
302 iso_pr_bacteria 8102223607 8102226293 553
303 iso_pr_bacteria 8102239244 8102241765 553
304 iso_pr_bacteria 8102251710 8102251807 553
305 3300007505 Ga0105005_1032673 Ga0105005_10326738 555
306 3300012809 Ga0160466_101089 Ga0160466_1010895 559
307 3300012852 Ga0160430_101164 Ga0160430_1011646 559
308 3300012854 Ga0160448_100841 Ga0160448_1008419 559
309 3300012829 Ga0160467_102682 Ga0160467_1026822 568
310 3300056814 Ga0562378_0015 Ga0562378_0015_30449_32164 571

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle 104 484 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.