Protein Family IF03746

Metagenome Isolate
292 Members
149 Samples
230 Scaffolds
416.95 Avg Length

🧬 Representative Sequence

ID
3300012829|Ga0160467_100248|Ga0160467_10024818
Length
461 aa
Sequence
VLNRKGGNEQFCLINDRIKIVNKTNLSKFVSLKIHTIMLQLNYIRENRDKVIERLGVKNFKEIGLVDEIITLDEQRRKIQSESDALSAEANSSAKKIGELMRQGKKEEAEAVKSQSSGYKEQIKSLTDHLDRVEQDLNAKIVQLPNLPHTTVPAGVSADDNEVVLENGTIPTLADDAVSHWDLLTKYGIVDLELGVKVTGAGFPVYKGKGARLQRALINFFLDEAAKVGYEEVQVPIMVNEASAFATGQLPDKEGQMYHVTHDDLYLIPTAEVPVTNIYRDVIVKEEQFPIRHCAYTPCFRREAGSYGAHVRGLNRLHQFDKVETVQIVHPDRSYDALEEMNTYVQGLLQKLELPYRVLRLCGGDMSFTAALTYDLEVYSAAQKRWLEVSSVSNFETYQSNRLKVRFKNQDGKMQLAHTLNGSALALPRIVASLLENNQTDKGIKIPKVLVPYTGFEYID*

πŸ“Š Sample Types

Isolate 21.2%
Metagenome 78.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 20.9%
Unclassified 14.2%
Blattidae 12.7%
Kalotermitidae 9.7%
Formicidae 5.2%
Armadillidiidae 4.5%
Apidae 3.7%
Rhinotermitidae 3.7%
Elmidae 3.0%
Passalidae 3.0%
Culicidae 3.0%
Drosophilidae 2.2%
Hydrophilidae 2.2%
Termopsidae 2.2%
Tenebrionidae 1.5%
Daphniidae 1.5%
Aphididae 0.7%
Pyroglyphidae 0.7%
Aphelinidae 0.7%
Nephropidae 0.7%
Delphacidae 0.7%
Hodotermitidae 0.7%
Cambaridae 0.7%
Bombycidae 0.7%
Kiwaidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 288
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2832372155 Apibacter adventoris wkB301 Isolate Apidae
2 2864836148 Arcicella rosea S00070 Isolate Elmidae
3 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
4 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
5 2896330536 Sphingobacterium sp. xlx-96 Isolate
6 2920168565 Paludibacter sp. 221 Isolate Blattidae
7 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
8 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
9 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
10 3000153175 Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 Isolate Pyroglyphidae
11 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
12 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
15 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
16 3300003131 Encarsia pergandiella symbiont microbial communities from Weslaco, Texas Metagenome Aphelinidae
17 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
18 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
19 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
20 2896321640 Sphingobacterium sp. xlx-130 Isolate
21 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
22 2922326829 Bacteroides sp. 224 Isolate Blattidae
23 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
26 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
27 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
28 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2832298047 Apibacter sp. wkB309 Isolate Apidae
33 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
34 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
35 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
36 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
37 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
38 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
39 3004672520 Bacteroides sp. 51 Isolate Blattidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
42 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
43 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
44 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
51 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
52 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
53 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
54 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
57 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
60 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
61 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
62 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
63 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
64 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
65 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
66 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
67 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
68 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
69 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
70 2896350215 Sphingobacterium sp. xlx-183 Isolate
71 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
72 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
73 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 2998907766 Penaeicola halotolerans LMIT005 Isolate
76 3004667792 Bacteroides sp. 519 Isolate Blattidae
77 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
78 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
79 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
80 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
81 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
82 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
83 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
84 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
85 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
86 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
87 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
88 2832343623 Apibacter adventoris wkB180 Isolate Apidae
89 2882250448 Bizionia sp. APA-3 Isolate
90 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
91 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
92 2923982719 Parabacteroides sp. 52 Isolate Blattidae
93 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
94 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
95 3000336795 Cardinium endosymbiont of Sogatella furcifera cSfur Isolate Delphacidae
96 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
97 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
98 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
99 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
100 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
101 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
102 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
103 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
104 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
105 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
106 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
107 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
108 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
109 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
110 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
111 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
112 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
113 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
114 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
115 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
116 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
117 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
118 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
119 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
120 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
121 3004677695 Bacteroides sp. 214 Isolate Blattidae
122 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
123 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
124 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
125 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
126 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
127 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
128 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
129 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
130 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
131 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
132 2898741527 Sphingobacterium sp. xlx-73 Isolate
133 2904728850 Flavobacterium sp. xlx-214 Isolate
134 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
135 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
136 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
137 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
138 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
139 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
140 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
141 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
142 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
143 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
144 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
145 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
146 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
147 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
148 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
149 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_217598 3300042621 Bacteria 2948
2 Ga0466729_296520 3300042621 Bacteria 9735
3 Ga0466731_336997 3300042622 Bacteria 40948
4 Ga0466704_481288 3300042643 Bacteria 19956
5 Ga0466723_086519 3300042618 Bacteria 25074
6 Ga0123357_10046829 3300009784 Bacteria 5864
7 Ga0123353_10003231 3300010167 Bacteria 20536
8 Ga0123354_10001016 3300010882 Bacteria 32074
9 Ga0160467_100181 3300012829 Bacteria 86124
10 Ga0160445_100325 3300012847 Bacteria 28697
11 Ga0265387_1001873 3300024582 Bacteria 3003
12 Ga0466696_327292 3300042596 Bacteria 13352
13 JGI24695J34938_10074771 3300002450 Bacteria 1409
14 JGI24702J35022_10009705 3300002462 Bacteria 5399
15 Ga0068305_10016620 3300005083 Bacteria 2476
16 Ga0072941_1028824 3300005201 Bacteria 5262
17 Ga0102740_1000098 3300007140 Bacteria 21610
18 Ga0466701_021588 3300042598 Bacteria 47878
19 Ga0466706_112878 3300042599 Bacteria 18095
20 Ga0466706_166086 3300042599 Bacteria 38734
21 Ga0466700_416655 3300042600 Bacteria 17402
22 Ga0466733_048665 3300042659 Bacteria 27056
23 Ga0466733_051738 3300042659 Bacteria 2431
24 Ga0466733_165496 3300042659 Bacteria 147790
25 Ga0466703_251310 3300042636 Bacteria 38401
26 Ga0466724_46543 3300042649 Bacteria 311178
27 Ga0466710_198423 3300042613 Bacteria 3170
28 Ga0466711_379326 3300042615 Bacteria 15263
29 Ga0123356_10109761 3300010049 Bacteria 2662
30 Ga0123353_10152727 3300010167 Bacteria 3684
31 Ga0160431_100784 3300012828 Bacteria 10619
32 Ga0160472_100040 3300012839 Bacteria 228958
33 Ga0265387_1003812 3300024582 Bacteria 2072
34 Ga0466691_129459 3300042593 Bacteria 115763
35 Ga0466694_051792 3300042594 Bacteria 23896
36 2227136350 2225789004 Bacteria 37050
37 2227391919 2225789004 Bacteria 5853
38 IMNBGM34_c000013 3300000036 Bacteria 51275
39 IMNBL1DRAFT_c0001288 3300000062 Bacteria 18888
40 Ga0103265_1000877 3300007068 Bacteria 5005
41 Ga0466701_031730 3300042598 Bacteria 202867
42 Ga0466701_097127 3300042598 Bacteria 5038
43 Ga0466706_011215 3300042599 Bacteria 27480
44 Ga0466706_053989 3300042599 Bacteria 17416
45 Ga0466713_025872 3300042602 Bacteria 7628
46 Ga0466713_064041 3300042602 Bacteria 54434
47 Ga0466713_155603 3300042602 Bacteria 10269
48 Ga0466714_129115 3300042603 Bacteria 5220
49 Ga0466698_187180 3300042610 Bacteria 1700
50 Ga0466697_004001 3300042611 Bacteria 4539
51 Ga0466705_295185 3300042612 Bacteria 3791
52 Ga0466724_40742 3300042649 Bacteria 1894
53 Ga0466727_263308 3300042655 Bacteria 66130
54 Ga0466711_481586 3300042615 Bacteria 4075
55 Ga0466715_471954 3300042616 Bacteria 11673
56 Ga0466726_271705 3300042619 Bacteria 2189
57 Ga0123357_10007479 3300009784 Bacteria 13506
58 Ga0123356_10001474 3300010049 Bacteria 25944
59 Ga0123356_10045620 3300010049 Bacteria 4078
60 Ga0160458_100063 3300012832 Bacteria 137674
61 Ga0160452_102952 3300012834 Bacteria 3237
62 Ga0160445_102958 3300012847 Unclassified 3635
63 Ga0466692_110825 3300042591 Bacteria 2211
64 Ga0466694_078292 3300042594 Bacteria 4289
65 2227044269 2225789003 Bacteria 4075
66 IMNBL1DRAFT_c0000168 3300000062 Bacteria 58839
67 JGI24705J35276_12227756 3300002504 Bacteria 3057
68 JGI24696J40584_12961705 3300002834 Bacteria 42529
69 Ga0052165_100034 3300003131 Bacteria 12069
70 Ga0104045_1001879 3300007085 Bacteria 4922
71 Ga0104045_1075732 3300007085 Bacteria 1840
72 Ga0104048_1001511 3300007143 Unclassified 4668
73 Ga0104019_1189767 3300007150 Unclassified 4194
74 Ga0466701_026886 3300042598 Bacteria 2176
75 Ga0466706_002764 3300042599 Bacteria 6869
76 Ga0466706_180584 3300042599 Bacteria 35920
77 Ga0466706_246163 3300042599 Bacteria 20466
78 Ga0466713_121587 3300042602 Bacteria 21118
79 Ga0466714_065131 3300042603 Bacteria 171349
80 Ga0466716_181049 3300042605 Bacteria 16159
81 Ga0466719_448992 3300042606 Bacteria 5270
82 Ga0466722_054620 3300042609 Bacteria 8464
83 Ga0466705_384768 3300042612 Bacteria 8548
84 Ga0466733_053801 3300042659 Bacteria 13129
85 Ga0466733_099961 3300042659 Bacteria 6831
86 Ga0466703_322755 3300042636 Bacteria 21047
87 Ga0466724_00918 3300042649 Bacteria 46721
88 Ga0466711_400416 3300042615 Bacteria 12160
89 Ga0466726_238283 3300042619 Bacteria 1608
90 Ga0123355_10000003 3300009826 Bacteria 224088
91 Ga0160469_100013 3300012824 Bacteria 444998
92 Ga0160445_100784 3300012847 Bacteria 11978
93 Ga0415639_177156 3300038395 Bacteria 1609
94 Ga0466692_155859 3300042591 Bacteria 17714
95 Ga0466701_002464 3300042598 Bacteria 3368
96 2227080801 2225789004 Bacteria 40926
97 JGI24702J35022_10011067 3300002462 Bacteria 5026
98 Ga0102735_1000137 3300007080 Bacteria 18922
99 Ga0102737_1000010 3300007142 Bacteria 59215
100 Ga0466706_176975 3300042599 Bacteria 27553
101 Ga0466707_284882 3300042601 Bacteria 17288
102 Ga0466716_108191 3300042605 Bacteria 8483
103 Ga0466705_154286 3300042612 Bacteria 18943
104 Ga0466732_175565 3300042656 Bacteria 5358
105 Ga0562377_0004 3300056842 Bacteria 3525959
106 Ga0466731_043145 3300042622 Bacteria 2923
107 Ga0466724_28891 3300042649 Bacteria 455231
108 Ga0466708_313602 3300042652 Bacteria 27720
109 Ga0466710_104711 3300042613 Bacteria 1457
110 Ga0466711_208704 3300042615 Bacteria 7773
111 Ga0466715_139469 3300042616 Bacteria 1899
112 Ga0466715_147559 3300042616 Bacteria 7945
113 Ga0123357_10092931 3300009784 Bacteria 3923
114 Ga0123357_10229400 3300009784 Bacteria 2039
115 Ga0123355_10001635 3300009826 Bacteria 31262
116 Ga0123355_10073062 3300009826 Bacteria 5499
117 Ga0123353_10000014 3300010167 Bacteria 204767
118 Ga0123353_10359660 3300010167 Bacteria 2188
119 Ga0160467_100072 3300012829 Bacteria 152638
120 Ga0160467_100248 3300012829 Bacteria 66505
121 Ga0160443_100028 3300012848 Bacteria 368417
122 Ga0160457_1000536 3300012858 Bacteria 16111
123 Ga0466657_271110 3300042582 Bacteria 2740
124 Ga0466657_363639 3300042582 Bacteria 11379
125 Ga0466690_035097 3300042590 Bacteria 7898
126 Ga0466690_118535 3300042590 Bacteria 11335
127 Ga0466690_170801 3300042590 Bacteria 10555
128 Ga0466692_127794 3300042591 Bacteria 5623
129 2226980392 2225789003 Bacteria 9223
130 HBC_ctgsDRAFT_1000005 3300000333 Bacteria 62596
131 JGI24702J35022_10001375 3300002462 Bacteria 15103
132 Ga0102734_1000152 3300007129 Bacteria 30183
133 Ga0466706_025836 3300042599 Bacteria 18233
134 Ga0466706_107334 3300042599 Bacteria 17627
135 Ga0466713_008208 3300042602 Bacteria 15690
136 Ga0466721_149539 3300042608 Bacteria 2583
137 Ga0466722_177733 3300042609 Bacteria 16531
138 Ga0466733_134143 3300042659 Bacteria 2235
139 Ga0466733_194732 3300042659 Bacteria 3551
140 Ga0466729_235356 3300042621 Bacteria 7488
141 Ga0466729_296569 3300042621 Bacteria 3872
142 Ga0466734_119570 3300042623 Bacteria 1949
143 Ga0466703_017812 3300042636 Bacteria 2358
144 Ga0466703_264690 3300042636 Bacteria 7503
145 Ga0466704_316152 3300042643 Bacteria 27672
146 Ga0466724_41267 3300042649 Bacteria 4756
147 Ga0466724_61209 3300042649 Bacteria 46468
148 Ga0466708_047168 3300042652 Bacteria 38721
149 Ga0466708_188840 3300042652 Bacteria 10953
150 Ga0466727_139559 3300042655 Bacteria 7534
151 Ga0466705_528133 3300042612 Bacteria 23688
152 Ga0466711_335669 3300042615 Bacteria 37569
153 Ga0466728_082257 3300042620 Bacteria 106309
154 Ga0123353_10031639 3300010167 Bacteria 8199
155 Ga0160454_100027 3300012798 Bacteria 281188
156 Ga0160453_100255 3300012814 Bacteria 51887
157 Ga0160447_100006 3300012849 Bacteria 523520
158 Ga0157631_128256 3300013007 Bacteria 5615
159 Ga0264413_160094 3300024493 Bacteria 1867
160 Ga0466690_218264 3300042590 Bacteria 18957
161 Ga0466696_103112 3300042596 Bacteria 3617
162 Ga0466699_117325 3300042597 Bacteria 3456
163 2227300238 2225789004 Bacteria 6607
164 JGI24702J35022_10005902 3300002462 Bacteria 7119
165 Ga0103267_1000141 3300007190 Bacteria 30888
166 Ga0466706_023664 3300042599 Bacteria 49263
167 Ga0466706_036645 3300042599 Bacteria 3497
168 Ga0466706_104443 3300042599 Bacteria 12483
169 Ga0466706_141992 3300042599 Bacteria 60260
170 Ga0466707_394110 3300042601 Bacteria 20693
171 Ga0466722_190847 3300042609 Bacteria 33466
172 Ga0466722_263274 3300042609 Bacteria 17083
173 Ga0466733_019878 3300042659 Bacteria 16830
174 Ga0466735_024891 3300042624 Bacteria 20434
175 Ga0466735_167579 3300042624 Bacteria 6447
176 Ga0466724_24857 3300042649 Bacteria 19395
177 Ga0466705_467594 3300042612 Bacteria 6333
178 Ga0466710_017247 3300042613 Bacteria 3730
179 Ga0466710_039174 3300042613 Bacteria 1502
180 Ga0466710_167340 3300042613 Bacteria 3084
181 Ga0466715_629769 3300042616 Bacteria 55391
182 Ga0466723_228061 3300042618 Bacteria 41593
183 Ga0466723_354982 3300042618 Bacteria 8959
184 Ga0466726_123595 3300042619 Bacteria 23616
185 Ga0123353_10298044 3300010167 Bacteria 2463
186 Ga0123354_10001525 3300010882 Bacteria 28373
187 Ga0123354_10001798 3300010882 Bacteria 27042
188 Ga0123354_10020333 3300010882 Bacteria 10440
189 Ga0123354_10096890 3300010882 Bacteria 4025
190 Ga0160433_100128 3300012846 Bacteria 68674
191 Ga0160433_100191 3300012846 Bacteria 50072
192 Ga0466657_182735 3300042582 Bacteria 91898
193 Ga0466695_221633 3300042595 Bacteria 1695
194 JGI24696J40584_12961226 3300002834 Bacteria 12327
195 CVPL010W_10002448 3300002931 Bacteria 23446
196 CVPL010W_10003663 3300002931 Bacteria 17633
197 Ga0104019_1001186 3300007150 Bacteria 12888
198 Ga0466701_082893 3300042598 Bacteria 37923
199 Ga0466706_058258 3300042599 Bacteria 2371
200 Ga0466706_124505 3300042599 Bacteria 42262
201 Ga0466700_309017 3300042600 Bacteria 3995
202 Ga0466698_133733 3300042610 Bacteria 3394
203 Ga0466705_194821 3300042612 Bacteria 15623
204 Ga0466733_217517 3300042659 Bacteria 12455
205 Ga0466704_280399 3300042643 Bacteria 59189
206 Ga0466710_024292 3300042613 Bacteria 3750
207 Ga0466710_191023 3300042613 Bacteria 3644
208 Ga0466711_287258 3300042615 Bacteria 26616
209 Ga0466715_201011 3300042616 Bacteria 16240
210 Ga0466718_081528 3300042617 Bacteria 1726
211 Ga0466723_233824 3300042618 Bacteria 4389
212 Ga0466729_053291 3300042621 Bacteria 1693
213 Ga0123353_10002366 3300010167 Bacteria 23421
214 Ga0123353_10004432 3300010167 Bacteria 18082
215 Ga0123354_10053229 3300010882 Bacteria 6088
216 Ga0160465_100328 3300012803 Bacteria 28159
217 Ga0160434_100235 3300012850 Bacteria 23458
218 Ga0466691_001983 3300042593 Bacteria 3214
219 IMNBL1DRAFT_c0003234 3300000062 Bacteria 10646
220 JGI24699J35502_11133978 3300002509 Bacteria 22406
221 Ga0104048_1001674 3300007143 Bacteria 15069
222 Ga0466701_086544 3300042598 Bacteria 103634
223 Ga0466706_115665 3300042599 Bacteria 6532
224 Ga0466706_138302 3300042599 Unclassified 2583
225 Ga0466706_215383 3300042599 Bacteria 1727
226 Ga0466706_263045 3300042599 Bacteria 5752
227 Ga0466713_023468 3300042602 Bacteria 115789
228 Ga0466719_259708 3300042606 Bacteria 13010
229 Ga0466719_292258 3300042606 Bacteria 3088
230 Ga0466722_189577 3300042609 Bacteria 4568

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10074771 JGI24695J34938_100747711 369
2 iso_pr_bacteria 2820797595 2820798600 371
3 3300002834 JGI24696J40584_12961226 JGI24696J40584_129612264 372
4 3300042582 Ga0466657_363639 Ga0466657_363639_4560_5834 372
5 3300042601 Ga0466707_394110 Ga0466707_394110_15285_16559 372
6 3300042613 Ga0466710_198423 Ga0466710_198423_436_1554 372
7 3300042605 Ga0466716_108191 Ga0466716_108191_1352_2623 377
8 3300042600 Ga0466700_309017 Ga0466700_309017_2845_3981 378
9 3300009826 Ga0123355_10001635 Ga0123355_1000163520 382
10 3300042603 Ga0466714_065131 Ga0466714_065131_89235_90506 383
11 3300042649 Ga0466724_28891 Ga0466724_28891_448512_449783 384
12 3300042598 Ga0466701_082893 Ga0466701_082893_1957_3228 386
13 3300007085 Ga0104045_1075732 Ga0104045_10757321 387
14 3300007150 Ga0104019_1189767 Ga0104019_11897673 387
15 3300009826 Ga0123355_10000003 Ga0123355_1000000325 387
16 3300024493 Ga0264413_160094 Ga0264413_1600942 390
17 3300042599 Ga0466706_263045 Ga0466706_263045_4172_5446 390
18 3300042613 Ga0466710_039174 Ga0466710_039174_134_1402 390
19 3300042582 Ga0466657_182735 Ga0466657_182735_74514_75785 391
20 3300042624 Ga0466735_167579 Ga0466735_167579_854_2125 391
21 3300024582 Ga0265387_1001873 Ga0265387_10018732 392
22 3300042652 Ga0466708_313602 Ga0466708_313602_7650_8918 392
23 3300042615 Ga0466711_481586 Ga0466711_481586_2606_3877 393
24 3300042619 Ga0466726_271705 Ga0466726_271705_448_1716 393
25 3300005201 Ga0072941_1028824 Ga0072941_10288243 394
26 3300007129 Ga0102734_1000152 Ga0102734_100015220 394
27 3300010167 Ga0123353_10152727 Ga0123353_101527274 394
28 3300042599 Ga0466706_138302 Ga0466706_138302_634_1908 394
29 3300042622 Ga0466731_336997 Ga0466731_336997_28643_29911 394
30 3300042659 Ga0466733_048665 Ga0466733_048665_21557_22828 394
31 3300007080 Ga0102735_1000137 Ga0102735_10001372 395
32 3300042615 Ga0466711_400416 Ga0466711_400416_4866_6134 395
33 3300007085 Ga0104045_1001879 Ga0104045_10018796 396
34 3300009826 Ga0123355_10073062 Ga0123355_100730623 396
35 3300042599 Ga0466706_176975 Ga0466706_176975_20062_21333 396
36 3300042608 Ga0466721_149539 Ga0466721_149539_120_1388 396
37 3300042623 Ga0466734_119570 Ga0466734_119570_331_1602 396
38 3300042599 Ga0466706_023664 Ga0466706_023664_17765_19036 397
39 3300042599 Ga0466706_025836 Ga0466706_025836_11136_12407 398
40 3300042619 Ga0466726_123595 Ga0466726_123595_1629_2894 398
41 3300042636 Ga0466703_017812 Ga0466703_017812_499_1764 398
42 2225789004 2227080801 2227454487 399
43 3300002462 JGI24702J35022_10001375 JGI24702J35022_1000137513 399
44 3300002931 CVPL010W_10003663 CVPL010W_1000366310 399
45 3300042598 Ga0466701_097127 Ga0466701_097127_3033_4304 399
46 3300000333 HBC_ctgsDRAFT_1000005 HBC_ctgsDRAFT_100000542 400
47 3300042593 Ga0466691_001983 Ga0466691_001983_966_2237 400
48 3300007068 Ga0103265_1000877 Ga0103265_10008771 401
49 3300007142 Ga0102737_1000010 Ga0102737_100001036 401
50 3300013007 Ga0157631_128256 Ga0157631_1282562 401
51 3300042599 Ga0466706_058258 Ga0466706_058258_204_1478 401
52 3300007143 Ga0104048_1001511 Ga0104048_10015112 402
53 3300007150 Ga0104019_1001186 Ga0104019_10011864 402
54 3300042610 Ga0466698_133733 Ga0466698_133733_2113_3381 402
55 3300042659 Ga0466733_134143 Ga0466733_134143_734_2005 402
56 3300042598 Ga0466701_021588 Ga0466701_021588_40791_42116 403
57 3300042599 Ga0466706_141992 Ga0466706_141992_17099_18373 404
58 3300000036 IMNBGM34_c000013 IMNBGM34_00001337 405
59 3300042599 Ga0466706_104443 Ga0466706_104443_8259_9533 405
60 3300042652 Ga0466708_047168 Ga0466708_047168_23005_24273 405
61 3300010882 Ga0123354_10001016 Ga0123354_100010169 406
62 3300042618 Ga0466723_086519 Ga0466723_086519_16599_17870 406
63 3300042649 Ga0466724_00918 Ga0466724_00918_27208_28479 406
64 3300042599 Ga0466706_053989 Ga0466706_053989_367_1590 407
65 3300042590 Ga0466690_170801 Ga0466690_170801_3530_4801 408
66 3300042609 Ga0466722_263274 Ga0466722_263274_12466_13746 408
67 3300002509 JGI24699J35502_11133978 JGI24699J35502_1113397821 409
68 3300012814 Ga0160453_100255 Ga0160453_10025518 409
69 3300042599 Ga0466706_107334 Ga0466706_107334_8991_10265 409
70 3300042591 Ga0466692_155859 Ga0466692_155859_10148_11419 410
71 3300002931 CVPL010W_10002448 CVPL010W_1000244813 411
72 3300042599 Ga0466706_115665 Ga0466706_115665_4695_5969 412
73 3300042599 Ga0466706_112878 Ga0466706_112878_4241_5515 413
74 3300002462 JGI24702J35022_10011067 JGI24702J35022_100110672 414
75 3300024582 Ga0265387_1003812 Ga0265387_10038122 414
76 3300042609 Ga0466722_177733 Ga0466722_177733_13089_14405 414
77 3300042612 Ga0466705_384768 Ga0466705_384768_1006_2277 415
78 3300042591 Ga0466692_127794 Ga0466692_127794_1665_2936 417
79 3300042593 Ga0466691_129459 Ga0466691_129459_72245_73513 417
80 3300038395 Ga0415639_177156 Ga0415639_177156_308_1579 418
81 3300042618 Ga0466723_233824 Ga0466723_233824_2681_3955 418
82 3300042591 Ga0466692_110825 Ga0466692_110825_182_1444 420
83 3300042599 Ga0466706_215383 Ga0466706_215383_136_1398 420
84 3300042621 Ga0466729_053291 Ga0466729_053291_113_1378 421
85 3300042621 Ga0466729_296520 Ga0466729_296520_3535_4800 421
86 2225789004 2227391919 2227836480 422
87 3300042582 Ga0466657_271110 Ga0466657_271110_663_1931 422
88 3300042590 Ga0466690_035097 Ga0466690_035097_6328_7596 422
89 3300042594 Ga0466694_051792 Ga0466694_051792_16555_17823 422
90 3300042594 Ga0466694_078292 Ga0466694_078292_201_1469 422
91 3300042596 Ga0466696_327292 Ga0466696_327292_6648_7916 422
92 3300042597 Ga0466699_117325 Ga0466699_117325_1051_2319 422
93 3300042598 Ga0466701_002464 Ga0466701_002464_1949_3217 422
94 3300042598 Ga0466701_031730 Ga0466701_031730_77043_78311 422
95 3300042598 Ga0466701_086544 Ga0466701_086544_45177_46445 422
96 3300042606 Ga0466719_259708 Ga0466719_259708_3530_4798 422
97 3300042611 Ga0466697_004001 Ga0466697_004001_1774_3042 422
98 3300042612 Ga0466705_528133 Ga0466705_528133_4899_6167 422
99 3300042613 Ga0466710_024292 Ga0466710_024292_1316_2584 422
100 3300042613 Ga0466710_104711 Ga0466710_104711_138_1406 422
101 3300042613 Ga0466710_167340 Ga0466710_167340_1017_2285 422
102 3300042613 Ga0466710_191023 Ga0466710_191023_1829_3097 422
103 3300042615 Ga0466711_335669 Ga0466711_335669_20986_22254 422
104 3300042616 Ga0466715_629769 Ga0466715_629769_25953_27221 422
105 3300042617 Ga0466718_081528 Ga0466718_081528_228_1496 422
106 3300042618 Ga0466723_228061 Ga0466723_228061_39663_40931 422
107 3300042619 Ga0466726_238283 Ga0466726_238283_16_1284 422
108 3300042621 Ga0466729_217598 Ga0466729_217598_1349_2617 422
109 3300042622 Ga0466731_043145 Ga0466731_043145_1446_2714 422
110 3300042643 Ga0466704_316152 Ga0466704_316152_19268_20536 422
111 3300042649 Ga0466724_40742 Ga0466724_40742_469_1737 422
112 3300042649 Ga0466724_41267 Ga0466724_41267_904_2172 422
113 3300042649 Ga0466724_46543 Ga0466724_46543_214283_215551 422
114 3300042655 Ga0466727_139559 Ga0466727_139559_1180_2448 422
115 3300042656 Ga0466732_175565 Ga0466732_175565_2054_3322 422
116 3300042659 Ga0466733_019878 Ga0466733_019878_5768_7036 422
117 iso_pr_bacteria 2820735654 2820736067 422
118 iso_pr_bacteria 2820753519 2820754841 422
119 iso_pr_bacteria 2820755292 2820756937 422
120 iso_pr_bacteria 2820783511 2820783914 422
121 iso_pr_bacteria 2820792843 2820793002 422
122 iso_pr_bacteria 2820795054 2820796288 422
123 iso_pr_bacteria 2832298047 2832300047 422
124 iso_pr_bacteria 2832343623 2832345149 422
125 iso_pr_bacteria 2832372155 2832372261 422
126 iso_pr_bacteria 2864891731 2864895069 422
127 iso_pr_bacteria 2921902974 2921904396 422
128 2225789003 2226980392 2227325064 423
129 2225789003 2227044269 2227403668 423
130 2225789004 2227136350 2227535813 423
131 2225789004 2227300238 2227750287 423
132 3300000062 IMNBL1DRAFT_c0001288 IMNBL1DRAFT_000128813 423
133 3300002462 JGI24702J35022_10005902 JGI24702J35022_1000590210 423
134 3300002462 JGI24702J35022_10009705 JGI24702J35022_100097053 423
135 3300002834 JGI24696J40584_12961705 JGI24696J40584_1296170532 423
136 3300007190 Ga0103267_1000141 Ga0103267_100014121 423
137 3300010049 Ga0123356_10001474 Ga0123356_100014743 423
138 3300010049 Ga0123356_10045620 Ga0123356_100456202 423
139 3300010167 Ga0123353_10002366 Ga0123353_100023666 423
140 3300010167 Ga0123353_10003231 Ga0123353_100032312 423
141 3300010167 Ga0123353_10004432 Ga0123353_100044329 423
142 3300010167 Ga0123353_10298044 Ga0123353_102980443 423
143 3300010167 Ga0123353_10359660 Ga0123353_103596601 423
144 3300042595 Ga0466695_221633 Ga0466695_221633_111_1382 423
145 3300042596 Ga0466696_103112 Ga0466696_103112_1115_2386 423
146 3300042598 Ga0466701_026886 Ga0466701_026886_80_1351 423
147 3300042599 Ga0466706_002764 Ga0466706_002764_3852_5123 423
148 3300042599 Ga0466706_036645 Ga0466706_036645_516_1787 423
149 3300042599 Ga0466706_124505 Ga0466706_124505_17019_18290 423
150 3300042599 Ga0466706_246163 Ga0466706_246163_16661_17932 423
151 3300042600 Ga0466700_416655 Ga0466700_416655_7395_8666 423
152 3300042601 Ga0466707_284882 Ga0466707_284882_1108_2379 423
153 3300042602 Ga0466713_008208 Ga0466713_008208_7378_8649 423
154 3300042602 Ga0466713_023468 Ga0466713_023468_4476_5747 423
155 3300042602 Ga0466713_025872 Ga0466713_025872_4692_5963 423
156 3300042602 Ga0466713_155603 Ga0466713_155603_4689_5960 423
157 3300042603 Ga0466714_129115 Ga0466714_129115_3083_4354 423
158 3300042606 Ga0466719_292258 Ga0466719_292258_360_1631 423
159 3300042610 Ga0466698_187180 Ga0466698_187180_305_1576 423
160 3300042612 Ga0466705_154286 Ga0466705_154286_2321_3592 423
161 3300042612 Ga0466705_295185 Ga0466705_295185_2173_3444 423
162 3300042613 Ga0466710_017247 Ga0466710_017247_2345_3616 423
163 3300042615 Ga0466711_379326 Ga0466711_379326_2816_4087 423
164 3300042616 Ga0466715_139469 Ga0466715_139469_132_1403 423
165 3300042616 Ga0466715_147559 Ga0466715_147559_5861_7132 423
166 3300042616 Ga0466715_471954 Ga0466715_471954_769_2040 423
167 3300042621 Ga0466729_235356 Ga0466729_235356_2386_3657 423
168 3300042624 Ga0466735_024891 Ga0466735_024891_16517_17788 423
169 3300042636 Ga0466703_251310 Ga0466703_251310_29837_31108 423
170 3300042649 Ga0466724_24857 Ga0466724_24857_78_1349 423
171 3300042649 Ga0466724_61209 Ga0466724_61209_32277_33548 423
172 3300042655 Ga0466727_263308 Ga0466727_263308_55982_57253 423
173 3300042659 Ga0466733_051738 Ga0466733_051738_333_1604 423
174 3300042659 Ga0466733_053801 Ga0466733_053801_6902_8173 423
175 3300042659 Ga0466733_099961 Ga0466733_099961_3717_4988 423
176 3300042659 Ga0466733_165496 Ga0466733_165496_1979_3250 423
177 3300042659 Ga0466733_194732 Ga0466733_194732_942_2213 423
178 3300042659 Ga0466733_217517 Ga0466733_217517_2511_3782 423
179 3300056842 Ga0562377_0004 Ga0562377_0004_1713062_1714333 423
180 iso_pr_bacteria 2579779088 2582239496 423
181 iso_pr_bacteria 2590828803 2592927947 423
182 iso_pr_bacteria 2695420931 2698109976 423
183 iso_pr_bacteria 2811995047 2812947029 423
184 iso_pr_bacteria 2820750388 2820750605 423
185 iso_pr_bacteria 2820757377 2820758254 423
186 iso_pr_bacteria 2820776227 2820778555 423
187 iso_pr_bacteria 2820788205 2820789423 423
188 iso_pr_bacteria 2838772460 2838774577 423
189 iso_pr_bacteria 2864836148 2864839011 423
190 iso_pr_bacteria 2864878056 2864878393 423
191 iso_pr_bacteria 2864886855 2864887921 423
192 iso_pr_bacteria 2873600114 2873600348 423
193 iso_pr_bacteria 2873610414 2873610722 423
194 iso_pr_bacteria 2873776654 2873779245 423
195 iso_pr_bacteria 2882250448 2882251076 423
196 iso_pr_bacteria 2894649344 2894649511 423
197 iso_pr_bacteria 2896321640 2896325502 423
198 iso_pr_bacteria 2896330536 2896330910 423
199 iso_pr_bacteria 2896350215 2896350759 423
200 iso_pr_bacteria 2898741527 2898741617 423
201 iso_pr_bacteria 2899132286 2899132777 423
202 iso_pr_bacteria 2904728850 2904731707 423
203 iso_pr_bacteria 2910942425 2910943969 423
204 iso_pr_bacteria 2910949487 2910952567 423
205 iso_pr_bacteria 2910959314 2910959733 423
206 iso_pr_bacteria 2920168565 2920168801 423
207 iso_pr_bacteria 2923982719 2923983537 423
208 iso_pr_bacteria 2940199050 2940200595 423
209 iso_pr_bacteria 2940202316 2940204267 423
210 iso_pr_bacteria 2940209341 2940211876 423
211 iso_pr_bacteria 2940346213 2940346909 423
212 iso_pr_bacteria 2940371297 2940371468 423
213 iso_pr_bacteria 3000336795 3000337418 423
214 iso_pr_bacteria 8065497608 8065499189 423
215 iso_pr_bacteria 8100166142 8100168631 423
216 3300000062 IMNBL1DRAFT_c0000168 IMNBL1DRAFT_000016848 424
217 3300000062 IMNBL1DRAFT_c0003234 IMNBL1DRAFT_00032346 424
218 3300002504 JGI24705J35276_12227756 JGI24705J35276_122277561 424
219 3300009784 Ga0123357_10007479 Ga0123357_1000747910 424
220 3300009784 Ga0123357_10046829 Ga0123357_100468293 424
221 3300009784 Ga0123357_10092931 Ga0123357_100929314 424
222 3300009784 Ga0123357_10229400 Ga0123357_102294001 424
223 3300010049 Ga0123356_10109761 Ga0123356_101097614 424
224 3300010167 Ga0123353_10031639 Ga0123353_100316397 424
225 3300010882 Ga0123354_10001525 Ga0123354_1000152520 424
226 3300010882 Ga0123354_10001798 Ga0123354_100017987 424
227 3300010882 Ga0123354_10020333 Ga0123354_100203336 424
228 3300010882 Ga0123354_10053229 Ga0123354_100532292 424
229 3300010882 Ga0123354_10096890 Ga0123354_100968903 424
230 3300012803 Ga0160465_100328 Ga0160465_10032821 424
231 3300012824 Ga0160469_100013 Ga0160469_100013234 424
232 3300012829 Ga0160467_100072 Ga0160467_10007294 424
233 3300012829 Ga0160467_100181 Ga0160467_10018164 424
234 3300012832 Ga0160458_100063 Ga0160458_10006382 424
235 3300012834 Ga0160452_102952 Ga0160452_1029522 424
236 3300012839 Ga0160472_100040 Ga0160472_100040185 424
237 3300012846 Ga0160433_100128 Ga0160433_10012840 424
238 3300012846 Ga0160433_100191 Ga0160433_10019133 424
239 3300012847 Ga0160445_100325 Ga0160445_10032516 424
240 3300012847 Ga0160445_100784 Ga0160445_1007844 424
241 3300012847 Ga0160445_102958 Ga0160445_1029582 424
242 3300012848 Ga0160443_100028 Ga0160443_100028158 424
243 3300012849 Ga0160447_100006 Ga0160447_100006165 424
244 3300012850 Ga0160434_100235 Ga0160434_10023513 424
245 3300012858 Ga0160457_1000536 Ga0160457_10005365 424
246 3300042590 Ga0466690_218264 Ga0466690_218264_2964_4238 424
247 3300042599 Ga0466706_011215 Ga0466706_011215_14653_15927 424
248 3300042599 Ga0466706_166086 Ga0466706_166086_30962_32236 424
249 3300042599 Ga0466706_180584 Ga0466706_180584_20260_21534 424
250 3300042602 Ga0466713_121587 Ga0466713_121587_4917_6191 424
251 3300042605 Ga0466716_181049 Ga0466716_181049_10361_11635 424
252 3300042606 Ga0466719_448992 Ga0466719_448992_970_2244 424
253 3300042609 Ga0466722_189577 Ga0466722_189577_512_1786 424
254 3300042612 Ga0466705_467594 Ga0466705_467594_1862_3136 424
255 3300042620 Ga0466728_082257 Ga0466728_082257_45056_46330 424
256 3300042636 Ga0466703_322755 Ga0466703_322755_9091_10365 424
257 3300042643 Ga0466704_280399 Ga0466704_280399_17548_18822 424
258 3300042643 Ga0466704_481288 Ga0466704_481288_14363_15637 424
259 iso_pr_bacteria 2609459943 2610740438 424
260 iso_pr_bacteria 2820746860 2820748385 424
261 iso_pr_bacteria 2820768849 2820769572 424
262 iso_pr_bacteria 2820774381 2820775757 424
263 iso_pr_bacteria 2922326829 2922326854 424
264 iso_pr_bacteria 2940193328 2940194035 424
265 iso_pr_bacteria 2940336608 2940337312 424
266 iso_pr_bacteria 2998907766 2998910581 424
267 iso_pr_bacteria 3004667792 3004667895 424
268 iso_pr_bacteria 3004672520 3004675369 424
269 3300005083 Ga0068305_10016620 Ga0068305_100166201 425
270 3300007140 Ga0102740_1000098 Ga0102740_10000984 425
271 3300010167 Ga0123353_10000014 Ga0123353_10000014133 425
272 3300012828 Ga0160431_100784 Ga0160431_1007849 425
273 3300042615 Ga0466711_287258 Ga0466711_287258_24813_26090 425
274 3300042616 Ga0466715_201011 Ga0466715_201011_5370_6647 425
275 iso_pr_bacteria 3004677695 3004677877 425
276 3300042602 Ga0466713_064041 Ga0466713_064041_22688_23968 426
277 3300042590 Ga0466690_118535 Ga0466690_118535_5457_6740 427
278 3300042612 Ga0466705_194821 Ga0466705_194821_8372_9655 427
279 3300042615 Ga0466711_208704 Ga0466711_208704_3551_4834 427
280 3300042636 Ga0466703_264690 Ga0466703_264690_1212_2495 427
281 iso_pr_bacteria 2998929858 2998931294 427
282 3300042609 Ga0466722_190847 Ga0466722_190847_20501_21790 429
283 3300042618 Ga0466723_354982 Ga0466723_354982_2985_4277 430
284 3300042609 Ga0466722_054620 Ga0466722_054620_900_2195 431
285 3300042621 Ga0466729_296569 Ga0466729_296569_1938_3257 439
286 3300042652 Ga0466708_188840 Ga0466708_188840_7703_9037 444
287 iso_pr_bacteria 3000153175 3000153915 448
288 iso_pr_bacteria 2910930387 2910933056 450
289 3300007143 Ga0104048_1001674 Ga0104048_100167411 459
290 3300003131 Ga0052165_100034 Ga0052165_1000342 461
291 3300012798 Ga0160454_100027 Ga0160454_100027120 461
292 3300012829 Ga0160467_100248 Ga0160467_10024818 461

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain 38 148 0.99
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 262 438 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.