Protein Family IF03731
Metagenome
Isolate
154
Members
92
Samples
124
Scaffolds
147.84
Avg Length
Representative Sequence
- ID
- 3300012825|Ga0160441_100728|Ga0160441_10072813
- Length
- 166 aa
- Sequence
- VIKEKEENNIFYLINQKQVNTLSYKTVSANKNTINKEWIVVDAEGEILGRLASEIAKVIRGKHKPSFTPHVDCGDNVIVINADKIRLTGNKLGDKVYVRYTGYPGGQRFITPKELLAKHPERIIEKAVRGMLPKNRLGRQLFKNLYVYAGTAHKHEAQNPTPVKF*
Sample Types
Isolate
19.5%
Metagenome
80.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.5%
Unclassified
24.1%
Kalotermitidae
10.8%
Armadillidiidae
7.2%
Drosophilidae
6.0%
Formicidae
6.0%
Aphididae
3.6%
Rhinotermitidae
3.6%
Culicidae
3.6%
Passalidae
2.4%
Hodotermitidae
1.2%
Daphniidae
1.2%
Hydrophilidae
1.2%
Bombycidae
1.2%
Termopsidae
1.2%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 6 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 10 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 11 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 12 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 13 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 17 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 18 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 19 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 20 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 24 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 25 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 26 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 27 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 28 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 29 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 37 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 44 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 45 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 46 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 47 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 48 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 51 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 52 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 53 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 54 | 2820893114 | Unclassified Actinobacteria Lab288P1bin125 | Isolate | Unclassified |
| 55 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 56 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 62 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 63 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 64 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 65 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 66 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 67 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 68 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 69 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 70 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 71 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 72 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 73 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 76 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 77 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 78 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 79 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 80 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 81 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 82 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 83 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 84 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 85 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 86 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 87 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 88 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 89 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 90 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 91 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 92 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160458_100016 | 3300012832 | Bacteria | 326466 |
| 2 | Ga0123357_10088683 | 3300009784 | Bacteria | 4041 |
| 3 | Ga0123355_10994530 | 3300009826 | Bacteria | 892 |
| 4 | Ga0123356_11492834 | 3300010049 | Bacteria | 834 |
| 5 | Ga0123353_10000803 | 3300010167 | Bacteria | 38182 |
| 6 | Ga0123353_10007633 | 3300010167 | Bacteria | 14658 |
| 7 | Ga0123354_10243830 | 3300010882 | Bacteria | 1841 |
| 8 | Ga0466704_357125 | 3300042643 | Bacteria | 50145 |
| 9 | Ga0466706_257744 | 3300042599 | Bacteria | 1875 |
| 10 | JGI24696J40584_12681741 | 3300002834 | Bacteria | 720 |
| 11 | Ga0104041_1032743 | 3300007106 | Unclassified | 3034 |
| 12 | Ga0102734_1001194 | 3300007129 | Bacteria | 6879 |
| 13 | Ga0466705_185215 | 3300042612 | Bacteria | 35309 |
| 14 | Ga0160441_100011 | 3300012825 | Bacteria | 461375 |
| 15 | Ga0160459_107847 | 3300012831 | Bacteria | 1330 |
| 16 | Ga0160455_106206 | 3300012837 | Unclassified | 1230 |
| 17 | Ga0123353_10083389 | 3300010167 | Bacteria | 5143 |
| 18 | Ga0466708_120231 | 3300042652 | Bacteria | 18641 |
| 19 | Ga0466714_144103 | 3300042603 | Bacteria | 3423 |
| 20 | IMNBGM34_c011611 | 3300000036 | Bacteria | 1106 |
| 21 | JGI24702J35022_10005736 | 3300002462 | Bacteria | 7236 |
| 22 | Ga0123357_10000022 | 3300009784 | Bacteria | 136656 |
| 23 | Ga0466705_052338 | 3300042612 | Bacteria | 3572 |
| 24 | Ga0466656_048646 | 3300042550 | Bacteria | 1256 |
| 25 | Ga0466657_088829 | 3300042582 | Bacteria | 1658 |
| 26 | Ga0123355_10000146 | 3300009826 | Bacteria | 84653 |
| 27 | Ga0123355_10495843 | 3300009826 | Bacteria | 1510 |
| 28 | Ga0123356_10050575 | 3300010049 | Bacteria | 3867 |
| 29 | Ga0123353_10001046 | 3300010167 | Bacteria | 33922 |
| 30 | Ga0160465_100020 | 3300012803 | Bacteria | 253724 |
| 31 | Ga0466735_051776 | 3300042624 | Bacteria | 31328 |
| 32 | Ga0466716_024070 | 3300042605 | Bacteria | 10307 |
| 33 | Ga0466722_249625 | 3300042609 | Bacteria | 6949 |
| 34 | Ga0074302_1135926 | 3300005316 | Unclassified | 2306 |
| 35 | Ga0160441_100728 | 3300012825 | Bacteria | 18095 |
| 36 | Ga0160467_100167 | 3300012829 | Bacteria | 90731 |
| 37 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 38 | Ga0160457_1002290 | 3300012858 | Bacteria | 4121 |
| 39 | Ga0466692_025918 | 3300042591 | Bacteria | 1028 |
| 40 | Ga0466691_077233 | 3300042593 | Bacteria | 1099 |
| 41 | Ga0123355_11484703 | 3300009826 | Bacteria | 662 |
| 42 | Ga0123356_10129898 | 3300010049 | Bacteria | 2466 |
| 43 | Ga0123356_10218677 | 3300010049 | Bacteria | 1960 |
| 44 | Ga0123353_10000181 | 3300010167 | Bacteria | 80450 |
| 45 | Ga0123353_10019902 | 3300010167 | Bacteria | 9998 |
| 46 | Ga0466734_166224 | 3300042623 | Bacteria | 1336 |
| 47 | Ga0466704_305892 | 3300042643 | Bacteria | 6289 |
| 48 | Ga0466709_230390 | 3300042648 | Bacteria | 1423 |
| 49 | Ga0466701_089345 | 3300042598 | Bacteria | 2300 |
| 50 | Ga0466700_160253 | 3300042600 | Bacteria | 1037 |
| 51 | Ga0466722_215198 | 3300042609 | Bacteria | 2753 |
| 52 | Ga0104045_1000156 | 3300007085 | Unclassified | 4852 |
| 53 | Ga0104045_1003360 | 3300007085 | Unclassified | 20403 |
| 54 | Ga0160460_100045 | 3300012845 | Bacteria | 232961 |
| 55 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 56 | Ga0160443_100011 | 3300012848 | Bacteria | 464596 |
| 57 | Ga0160457_1000010 | 3300012858 | Bacteria | 500717 |
| 58 | Ga0466693_292622 | 3300042592 | Bacteria | 1412 |
| 59 | Ga0123357_10243837 | 3300009784 | Bacteria | 1939 |
| 60 | Ga0123356_11420140 | 3300010049 | Bacteria | 854 |
| 61 | Ga0123353_12005047 | 3300010167 | Unclassified | 709 |
| 62 | Ga0123354_10196624 | 3300010882 | Bacteria | 2235 |
| 63 | Ga0466724_18033 | 3300042649 | Bacteria | 6463 |
| 64 | Ga0466701_039882 | 3300042598 | Unclassified | 32438 |
| 65 | Ga0466707_002624 | 3300042601 | Bacteria | 3892 |
| 66 | Ga0466714_137227 | 3300042603 | Unclassified | 1835 |
| 67 | Ga0466719_052532 | 3300042606 | Bacteria | 2788 |
| 68 | Ga0466722_266387 | 3300042609 | Bacteria | 22057 |
| 69 | JGI24703J35330_11554715 | 3300002501 | Bacteria | 1236 |
| 70 | Ga0072941_1157778 | 3300005201 | Bacteria | 1554 |
| 71 | Ga0466697_145078 | 3300042611 | Bacteria | 2800 |
| 72 | Ga0466693_308632 | 3300042592 | Unclassified | 3208 |
| 73 | Ga0123355_11523057 | 3300009826 | Unclassified | 650 |
| 74 | Ga0123356_10011510 | 3300010049 | Bacteria | 8621 |
| 75 | Ga0123353_10598769 | 3300010167 | Bacteria | 1576 |
| 76 | Ga0123353_11029080 | 3300010167 | Bacteria | 1103 |
| 77 | Ga0123354_10270162 | 3300010882 | Bacteria | 1676 |
| 78 | Ga0466734_054379 | 3300042623 | Bacteria | 1386 |
| 79 | Ga0466709_180899 | 3300042648 | Bacteria | 11116 |
| 80 | Ga0466724_07606 | 3300042649 | Bacteria | 33899 |
| 81 | Ga0466711_010092 | 3300042615 | Bacteria | 2165 |
| 82 | Ga0466714_042598 | 3300042603 | Bacteria | 7660 |
| 83 | IMNBL1DRAFT_c0006096 | 3300000062 | Bacteria | 6697 |
| 84 | JGI24696J40584_12928791 | 3300002834 | Bacteria | 1444 |
| 85 | Ga0102739_1015175 | 3300007095 | Unclassified | 992 |
| 86 | Ga0466732_390063 | 3300042656 | Bacteria | 3100 |
| 87 | Ga0160452_104044 | 3300012834 | Bacteria | 2389 |
| 88 | Ga0466657_015097 | 3300042582 | Bacteria | 157741 |
| 89 | Ga0123355_10025167 | 3300009826 | Bacteria | 9581 |
| 90 | Ga0123356_11056492 | 3300010049 | Unclassified | 981 |
| 91 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 92 | Ga0123353_10894215 | 3300010167 | Bacteria | 1210 |
| 93 | Ga0466725_192127 | 3300042654 | Bacteria | 1207 |
| 94 | Ga0466722_018550 | 3300042609 | Bacteria | 38972 |
| 95 | IMNBL1DRAFT_c0179385 | 3300000062 | Bacteria | 535 |
| 96 | CVPL010W_10002427 | 3300002931 | Bacteria | 48318 |
| 97 | Ga0104045_1026879 | 3300007085 | Bacteria | 5274 |
| 98 | Ga0104041_1117983 | 3300007106 | Unclassified | 1167 |
| 99 | Ga0104044_1023493 | 3300007136 | Bacteria | 653 |
| 100 | Ga0102740_1000604 | 3300007140 | Unclassified | 9816 |
| 101 | Ga0466697_281117 | 3300042611 | Bacteria | 1520 |
| 102 | Ga0160445_100491 | 3300012847 | Bacteria | 19562 |
| 103 | Ga0160445_101295 | 3300012847 | Bacteria | 7397 |
| 104 | Ga0456237_0007521 | 3300041968 | Bacteria | 1674 |
| 105 | Ga0466695_255405 | 3300042595 | Bacteria | 1210 |
| 106 | Ga0466696_184988 | 3300042596 | Bacteria | 2594 |
| 107 | Ga0123357_10133160 | 3300009784 | Bacteria | 3085 |
| 108 | Ga0123355_10006244 | 3300009826 | Bacteria | 17604 |
| 109 | Ga0123355_10186530 | 3300009826 | Bacteria | 3065 |
| 110 | Ga0123356_10125463 | 3300010049 | Bacteria | 2505 |
| 111 | Ga0123356_11135245 | 3300010049 | Bacteria | 949 |
| 112 | Ga0123356_11324613 | 3300010049 | Bacteria | 883 |
| 113 | Ga0123356_11913883 | 3300010049 | Bacteria | 739 |
| 114 | Ga0123353_10019146 | 3300010167 | Bacteria | 10157 |
| 115 | Ga0123353_10377036 | 3300010167 | Bacteria | 2124 |
| 116 | Ga0123353_10590236 | 3300010167 | Bacteria | 1591 |
| 117 | Ga0466709_275063 | 3300042648 | Bacteria | 136526 |
| 118 | Ga0466710_290726 | 3300042613 | Bacteria | 60149 |
| 119 | Ga0466718_132302 | 3300042617 | Bacteria | 1275 |
| 120 | Ga0466722_076941 | 3300042609 | Bacteria | 36712 |
| 121 | Ga0072941_1635574 | 3300005201 | Bacteria | 970 |
| 122 | Ga0104043_1097125 | 3300007058 | Bacteria | 814 |
| 123 | Ga0102735_1000692 | 3300007080 | Bacteria | 8089 |
| 124 | Ga0123357_10000183 | 3300009784 | Bacteria | 57952 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_052532 | Ga0466719_052532_2039_2455 | 138 |
| 2 | 3300042643 | Ga0466704_305892 | Ga0466704_305892_3937_4353 | 138 |
| 3 | 3300010049 | Ga0123356_11324613 | Ga0123356_113246132 | 140 |
| 4 | 3300010167 | Ga0123353_12005047 | Ga0123353_120050471 | 140 |
| 5 | 3300042601 | Ga0466707_002624 | Ga0466707_002624_435_857 | 140 |
| 6 | 3300042609 | Ga0466722_076941 | Ga0466722_076941_17164_17592 | 142 |
| 7 | 3300042609 | Ga0466722_215198 | Ga0466722_215198_1055_1483 | 142 |
| 8 | 3300042609 | Ga0466722_249625 | Ga0466722_249625_6179_6607 | 142 |
| 9 | 3300042613 | Ga0466710_290726 | Ga0466710_290726_59185_59613 | 142 |
| 10 | 3300042617 | Ga0466718_132302 | Ga0466718_132302_330_758 | 142 |
| 11 | iso_pr_bacteria | 2843639003 | 2843639255 | 142 |
| 12 | iso_pr_bacteria | 2884500114 | 2884500366 | 142 |
| 13 | iso_pr_bacteria | 650716012 | 650926453 | 142 |
| 14 | iso_pr_bacteria | 2820573558 | 2820576295 | 143 |
| 15 | 3300042582 | Ga0466657_088829 | Ga0466657_088829_722_1156 | 144 |
| 16 | 3300042591 | Ga0466692_025918 | Ga0466692_025918_115_549 | 144 |
| 17 | 3300042592 | Ga0466693_292622 | Ga0466693_292622_470_904 | 144 |
| 18 | 3300042593 | Ga0466691_077233 | Ga0466691_077233_412_846 | 144 |
| 19 | 3300042595 | Ga0466695_255405 | Ga0466695_255405_157_591 | 144 |
| 20 | 3300042599 | Ga0466706_257744 | Ga0466706_257744_756_1190 | 144 |
| 21 | 3300042600 | Ga0466700_160253 | Ga0466700_160253_404_838 | 144 |
| 22 | 3300042605 | Ga0466716_024070 | Ga0466716_024070_2881_3315 | 144 |
| 23 | 3300042609 | Ga0466722_018550 | Ga0466722_018550_34938_35372 | 144 |
| 24 | 3300042648 | Ga0466709_230390 | Ga0466709_230390_331_765 | 144 |
| 25 | 3300042652 | Ga0466708_120231 | Ga0466708_120231_4733_5167 | 144 |
| 26 | 3300042654 | Ga0466725_192127 | Ga0466725_192127_745_1179 | 144 |
| 27 | iso_pr_bacteria | 2820848511 | 2820848659 | 144 |
| 28 | iso_pr_bacteria | 2820854745 | 2820854936 | 144 |
| 29 | iso_pr_bacteria | 2820870086 | 2820870300 | 144 |
| 30 | iso_pr_bacteria | 2820873081 | 2820873663 | 144 |
| 31 | iso_pr_bacteria | 2820880921 | 2820882084 | 144 |
| 32 | iso_pr_bacteria | 2820893114 | 2820893753 | 144 |
| 33 | iso_pr_bacteria | 2820907832 | 2820909328 | 144 |
| 34 | iso_pr_bacteria | 2820934415 | 2820935458 | 144 |
| 35 | iso_pr_bacteria | 2820942695 | 2820943645 | 144 |
| 36 | iso_pr_bacteria | 2821322763 | 2821323324 | 144 |
| 37 | 3300000062 | IMNBL1DRAFT_c0179385 | IMNBL1DRAFT_01793851 | 145 |
| 38 | 3300009784 | Ga0123357_10088683 | Ga0123357_100886833 | 145 |
| 39 | 3300009826 | Ga0123355_10186530 | Ga0123355_101865302 | 145 |
| 40 | 3300009826 | Ga0123355_11523057 | Ga0123355_115230572 | 145 |
| 41 | 3300010049 | Ga0123356_10125463 | Ga0123356_101254631 | 145 |
| 42 | 3300010049 | Ga0123356_10218677 | Ga0123356_102186773 | 145 |
| 43 | 3300010049 | Ga0123356_11056492 | Ga0123356_110564922 | 145 |
| 44 | 3300010049 | Ga0123356_11420140 | Ga0123356_114201402 | 145 |
| 45 | 3300010167 | Ga0123353_10000181 | Ga0123353_1000018114 | 145 |
| 46 | 3300010167 | Ga0123353_10000803 | Ga0123353_100008034 | 145 |
| 47 | 3300010167 | Ga0123353_10007633 | Ga0123353_100076338 | 145 |
| 48 | 3300010167 | Ga0123353_10019902 | Ga0123353_100199024 | 145 |
| 49 | 3300010167 | Ga0123353_11029080 | Ga0123353_110290802 | 145 |
| 50 | 3300010882 | Ga0123354_10243830 | Ga0123354_102438304 | 145 |
| 51 | 3300010882 | Ga0123354_10270162 | Ga0123354_102701623 | 145 |
| 52 | iso_pr_bacteria | 2820501819 | 2820502809 | 145 |
| 53 | iso_pr_bacteria | 2820856540 | 2820857351 | 145 |
| 54 | 3300000036 | IMNBGM34_c011611 | IMNBGM34_0116112 | 146 |
| 55 | 3300000062 | IMNBL1DRAFT_c0006096 | IMNBL1DRAFT_00060966 | 146 |
| 56 | 3300002501 | JGI24703J35330_11554715 | JGI24703J35330_115547153 | 146 |
| 57 | 3300009826 | Ga0123355_10495843 | Ga0123355_104958432 | 146 |
| 58 | 3300009826 | Ga0123355_10994530 | Ga0123355_109945301 | 146 |
| 59 | 3300010049 | Ga0123356_11135245 | Ga0123356_111352452 | 146 |
| 60 | 3300010049 | Ga0123356_11492834 | Ga0123356_114928341 | 146 |
| 61 | 3300010167 | Ga0123353_10019146 | Ga0123353_1001914611 | 146 |
| 62 | 3300042611 | Ga0466697_145078 | Ga0466697_145078_1376_1816 | 146 |
| 63 | 3300042611 | Ga0466697_281117 | Ga0466697_281117_818_1258 | 146 |
| 64 | 3300042643 | Ga0466704_357125 | Ga0466704_357125_14855_15295 | 146 |
| 65 | 3300009826 | Ga0123355_10000146 | Ga0123355_1000014652 | 147 |
| 66 | 3300009826 | Ga0123355_10006244 | Ga0123355_1000624418 | 147 |
| 67 | 3300009826 | Ga0123355_10025167 | Ga0123355_100251678 | 147 |
| 68 | 3300010167 | Ga0123353_10083389 | Ga0123353_100833894 | 147 |
| 69 | 3300010882 | Ga0123354_10196624 | Ga0123354_101966242 | 147 |
| 70 | 3300042598 | Ga0466701_039882 | Ga0466701_039882_99_542 | 147 |
| 71 | 3300042649 | Ga0466724_07606 | Ga0466724_07606_152_595 | 147 |
| 72 | 3300042649 | Ga0466724_18033 | Ga0466724_18033_2076_2519 | 147 |
| 73 | iso_pr_bacteria | 2579779088 | 2582236920 | 147 |
| 74 | iso_pr_bacteria | 2590828803 | 2592926991 | 147 |
| 75 | iso_pr_bacteria | 2820137450 | 2820138001 | 147 |
| 76 | iso_pr_bacteria | 2873776654 | 2873778266 | 147 |
| 77 | iso_pr_bacteria | 2896321640 | 2896323553 | 147 |
| 78 | iso_pr_bacteria | 2896330536 | 2896332063 | 147 |
| 79 | iso_pr_bacteria | 2896350215 | 2896351874 | 147 |
| 80 | iso_pr_bacteria | 2898741527 | 2898743792 | 147 |
| 81 | 3300002931 | CVPL010W_10002427 | CVPL010W_1000242734 | 148 |
| 82 | 3300005316 | Ga0074302_1135926 | Ga0074302_11359263 | 148 |
| 83 | 3300007058 | Ga0104043_1097125 | Ga0104043_10971252 | 148 |
| 84 | 3300007080 | Ga0102735_1000692 | Ga0102735_10006923 | 148 |
| 85 | 3300007085 | Ga0104045_1000156 | Ga0104045_10001564 | 148 |
| 86 | 3300007085 | Ga0104045_1003360 | Ga0104045_10033609 | 148 |
| 87 | 3300007085 | Ga0104045_1026879 | Ga0104045_102687910 | 148 |
| 88 | 3300007095 | Ga0102739_1015175 | Ga0102739_10151752 | 148 |
| 89 | 3300007106 | Ga0104041_1032743 | Ga0104041_10327434 | 148 |
| 90 | 3300007106 | Ga0104041_1117983 | Ga0104041_11179832 | 148 |
| 91 | 3300007129 | Ga0102734_1001194 | Ga0102734_10011948 | 148 |
| 92 | 3300007136 | Ga0104044_1023493 | Ga0104044_10234931 | 148 |
| 93 | 3300007140 | Ga0102740_1000604 | Ga0102740_100060410 | 148 |
| 94 | 3300010049 | Ga0123356_10011510 | Ga0123356_1001151010 | 148 |
| 95 | 3300012803 | Ga0160465_100020 | Ga0160465_100020157 | 148 |
| 96 | 3300012825 | Ga0160441_100011 | Ga0160441_100011191 | 148 |
| 97 | 3300012829 | Ga0160467_100167 | Ga0160467_10016785 | 148 |
| 98 | 3300012831 | Ga0160459_107847 | Ga0160459_1078473 | 148 |
| 99 | 3300012832 | Ga0160458_100016 | Ga0160458_10001614 | 148 |
| 100 | 3300012834 | Ga0160452_104044 | Ga0160452_1040444 | 148 |
| 101 | 3300012837 | Ga0160455_106206 | Ga0160455_1062061 | 148 |
| 102 | 3300012845 | Ga0160460_100045 | Ga0160460_100045103 | 148 |
| 103 | 3300012846 | Ga0160433_100012 | Ga0160433_10001284 | 148 |
| 104 | 3300012847 | Ga0160445_100491 | Ga0160445_1004915 | 148 |
| 105 | 3300012847 | Ga0160445_101295 | Ga0160445_1012953 | 148 |
| 106 | 3300012848 | Ga0160443_100011 | Ga0160443_10001155 | 148 |
| 107 | 3300012848 | Ga0160443_100103 | Ga0160443_10010384 | 148 |
| 108 | 3300012858 | Ga0160457_1000010 | Ga0160457_100001014 | 148 |
| 109 | 3300012858 | Ga0160457_1002290 | Ga0160457_10022903 | 148 |
| 110 | 3300009784 | Ga0123357_10243837 | Ga0123357_102438373 | 149 |
| 111 | 3300010049 | Ga0123356_10050575 | Ga0123356_100505751 | 149 |
| 112 | 3300042612 | Ga0466705_052338 | Ga0466705_052338_1815_2264 | 149 |
| 113 | 3300002834 | JGI24696J40584_12928791 | JGI24696J40584_129287912 | 150 |
| 114 | 3300042550 | Ga0466656_048646 | Ga0466656_048646_210_665 | 151 |
| 115 | 3300042582 | Ga0466657_015097 | Ga0466657_015097_18836_19291 | 151 |
| 116 | 3300042596 | Ga0466696_184988 | Ga0466696_184988_954_1409 | 151 |
| 117 | 3300042598 | Ga0466701_089345 | Ga0466701_089345_819_1274 | 151 |
| 118 | 3300042603 | Ga0466714_042598 | Ga0466714_042598_3025_3480 | 151 |
| 119 | 3300042603 | Ga0466714_137227 | Ga0466714_137227_181_636 | 151 |
| 120 | 3300042603 | Ga0466714_144103 | Ga0466714_144103_569_1024 | 151 |
| 121 | 3300042615 | Ga0466711_010092 | Ga0466711_010092_631_1086 | 151 |
| 122 | 3300042623 | Ga0466734_054379 | Ga0466734_054379_382_837 | 151 |
| 123 | 3300042623 | Ga0466734_166224 | Ga0466734_166224_211_666 | 151 |
| 124 | 3300042624 | Ga0466735_051776 | Ga0466735_051776_15889_16344 | 151 |
| 125 | 3300042648 | Ga0466709_180899 | Ga0466709_180899_2645_3100 | 151 |
| 126 | 3300042648 | Ga0466709_275063 | Ga0466709_275063_34026_34481 | 151 |
| 127 | 3300042656 | Ga0466732_390063 | Ga0466732_390063_104_559 | 151 |
| 128 | iso_pr_bacteria | 2820737921 | 2820738959 | 151 |
| 129 | iso_pr_bacteria | 2820768849 | 2820769594 | 151 |
| 130 | iso_pr_bacteria | 2820774381 | 2820775779 | 151 |
| 131 | iso_pr_bacteria | 637000113 | 638060657 | 151 |
| 132 | 3300002462 | JGI24702J35022_10005736 | JGI24702J35022_100057369 | 152 |
| 133 | 3300002834 | JGI24696J40584_12681741 | JGI24696J40584_126817411 | 152 |
| 134 | 3300005201 | Ga0072941_1157778 | Ga0072941_11577783 | 152 |
| 135 | 3300005201 | Ga0072941_1635574 | Ga0072941_16355742 | 152 |
| 136 | 3300009784 | Ga0123357_10133160 | Ga0123357_101331602 | 152 |
| 137 | 3300010049 | Ga0123356_10129898 | Ga0123356_101298982 | 152 |
| 138 | 3300010049 | Ga0123356_11913883 | Ga0123356_119138831 | 152 |
| 139 | 3300010167 | Ga0123353_10000014 | Ga0123353_10000014153 | 152 |
| 140 | 3300010167 | Ga0123353_10377036 | Ga0123353_103770363 | 152 |
| 141 | 3300010167 | Ga0123353_10598769 | Ga0123353_105987692 | 152 |
| 142 | 3300010167 | Ga0123353_10894215 | Ga0123353_108942151 | 152 |
| 143 | 3300042609 | Ga0466722_266387 | Ga0466722_266387_9048_9506 | 152 |
| 144 | 3300042612 | Ga0466705_185215 | Ga0466705_185215_16718_17179 | 153 |
| 145 | 3300009826 | Ga0123355_11484703 | Ga0123355_114847031 | 154 |
| 146 | 3300041968 | Ga0456237_0007521 | Ga0456237_0007521_413_880 | 155 |
| 147 | 3300010167 | Ga0123353_10001046 | Ga0123353_100010462 | 158 |
| 148 | 3300010167 | Ga0123353_10590236 | Ga0123353_105902361 | 162 |
| 149 | 3300042592 | Ga0466693_308632 | Ga0466693_308632_935_1429 | 164 |
| 150 | iso_pr_bacteria | 2820106212 | 2820107909 | 164 |
| 151 | iso_pr_bacteria | 2820111668 | 2820111731 | 164 |
| 152 | 3300009784 | Ga0123357_10000022 | Ga0123357_1000002264 | 165 |
| 153 | 3300009784 | Ga0123357_10000183 | Ga0123357_1000018335 | 165 |
| 154 | 3300012825 | Ga0160441_100728 | Ga0160441_10072813 | 166 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00572 | Ribosomal_L13 | Ribosomal protein L13 | 36 | 153 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.