Protein Family IF03731

Metagenome Isolate
154 Members
92 Samples
124 Scaffolds
147.84 Avg Length

🧬 Representative Sequence

ID
3300012825|Ga0160441_100728|Ga0160441_10072813
Length
166 aa
Sequence
VIKEKEENNIFYLINQKQVNTLSYKTVSANKNTINKEWIVVDAEGEILGRLASEIAKVIRGKHKPSFTPHVDCGDNVIVINADKIRLTGNKLGDKVYVRYTGYPGGQRFITPKELLAKHPERIIEKAVRGMLPKNRLGRQLFKNLYVYAGTAHKHEAQNPTPVKF*

📊 Sample Types

Isolate 19.5%
Metagenome 80.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 26.5%
Unclassified 24.1%
Kalotermitidae 10.8%
Armadillidiidae 7.2%
Drosophilidae 6.0%
Formicidae 6.0%
Aphididae 3.6%
Rhinotermitidae 3.6%
Culicidae 3.6%
Passalidae 2.4%
Hodotermitidae 1.2%
Daphniidae 1.2%
Hydrophilidae 1.2%
Bombycidae 1.2%
Termopsidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2898741527 Sphingobacterium sp. xlx-73 Isolate
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 637000113 Francisella tularensis tularensis FSC 198 Isolate
6 650716012 Buchnera aphidicola Ct Isolate Aphididae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
10 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
11 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
12 2896321640 Sphingobacterium sp. xlx-130 Isolate
13 2884500114 Buchnera aphidicola BuCicuneomaculata/2628 Isolate Aphididae
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
17 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
18 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
19 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
20 2896350215 Sphingobacterium sp. xlx-183 Isolate
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
24 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
25 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
26 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
27 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
28 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
29 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
37 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
38 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
39 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
44 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
45 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
46 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
47 2896330536 Sphingobacterium sp. xlx-96 Isolate
48 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
49 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
50 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
51 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
52 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
53 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
54 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
55 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
56 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
62 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
63 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
64 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
65 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
66 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
67 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
68 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
69 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
70 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
71 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
72 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
73 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
74 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
75 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
76 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
77 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
80 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
81 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
82 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
83 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
84 2843639003 Buchnera aphidicola BuCistrobi/3249 Isolate Aphididae
85 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
86 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
87 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
88 3300007136 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut Metagenome Drosophilidae
89 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
90 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
91 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
92 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160458_100016 3300012832 Bacteria 326466
2 Ga0123357_10088683 3300009784 Bacteria 4041
3 Ga0123355_10994530 3300009826 Bacteria 892
4 Ga0123356_11492834 3300010049 Bacteria 834
5 Ga0123353_10000803 3300010167 Bacteria 38182
6 Ga0123353_10007633 3300010167 Bacteria 14658
7 Ga0123354_10243830 3300010882 Bacteria 1841
8 Ga0466704_357125 3300042643 Bacteria 50145
9 Ga0466706_257744 3300042599 Bacteria 1875
10 JGI24696J40584_12681741 3300002834 Bacteria 720
11 Ga0104041_1032743 3300007106 Unclassified 3034
12 Ga0102734_1001194 3300007129 Bacteria 6879
13 Ga0466705_185215 3300042612 Bacteria 35309
14 Ga0160441_100011 3300012825 Bacteria 461375
15 Ga0160459_107847 3300012831 Bacteria 1330
16 Ga0160455_106206 3300012837 Unclassified 1230
17 Ga0123353_10083389 3300010167 Bacteria 5143
18 Ga0466708_120231 3300042652 Bacteria 18641
19 Ga0466714_144103 3300042603 Bacteria 3423
20 IMNBGM34_c011611 3300000036 Bacteria 1106
21 JGI24702J35022_10005736 3300002462 Bacteria 7236
22 Ga0123357_10000022 3300009784 Bacteria 136656
23 Ga0466705_052338 3300042612 Bacteria 3572
24 Ga0466656_048646 3300042550 Bacteria 1256
25 Ga0466657_088829 3300042582 Bacteria 1658
26 Ga0123355_10000146 3300009826 Bacteria 84653
27 Ga0123355_10495843 3300009826 Bacteria 1510
28 Ga0123356_10050575 3300010049 Bacteria 3867
29 Ga0123353_10001046 3300010167 Bacteria 33922
30 Ga0160465_100020 3300012803 Bacteria 253724
31 Ga0466735_051776 3300042624 Bacteria 31328
32 Ga0466716_024070 3300042605 Bacteria 10307
33 Ga0466722_249625 3300042609 Bacteria 6949
34 Ga0074302_1135926 3300005316 Unclassified 2306
35 Ga0160441_100728 3300012825 Bacteria 18095
36 Ga0160467_100167 3300012829 Bacteria 90731
37 Ga0160443_100103 3300012848 Bacteria 135933
38 Ga0160457_1002290 3300012858 Bacteria 4121
39 Ga0466692_025918 3300042591 Bacteria 1028
40 Ga0466691_077233 3300042593 Bacteria 1099
41 Ga0123355_11484703 3300009826 Bacteria 662
42 Ga0123356_10129898 3300010049 Bacteria 2466
43 Ga0123356_10218677 3300010049 Bacteria 1960
44 Ga0123353_10000181 3300010167 Bacteria 80450
45 Ga0123353_10019902 3300010167 Bacteria 9998
46 Ga0466734_166224 3300042623 Bacteria 1336
47 Ga0466704_305892 3300042643 Bacteria 6289
48 Ga0466709_230390 3300042648 Bacteria 1423
49 Ga0466701_089345 3300042598 Bacteria 2300
50 Ga0466700_160253 3300042600 Bacteria 1037
51 Ga0466722_215198 3300042609 Bacteria 2753
52 Ga0104045_1000156 3300007085 Unclassified 4852
53 Ga0104045_1003360 3300007085 Unclassified 20403
54 Ga0160460_100045 3300012845 Bacteria 232961
55 Ga0160433_100012 3300012846 Bacteria 265415
56 Ga0160443_100011 3300012848 Bacteria 464596
57 Ga0160457_1000010 3300012858 Bacteria 500717
58 Ga0466693_292622 3300042592 Bacteria 1412
59 Ga0123357_10243837 3300009784 Bacteria 1939
60 Ga0123356_11420140 3300010049 Bacteria 854
61 Ga0123353_12005047 3300010167 Unclassified 709
62 Ga0123354_10196624 3300010882 Bacteria 2235
63 Ga0466724_18033 3300042649 Bacteria 6463
64 Ga0466701_039882 3300042598 Unclassified 32438
65 Ga0466707_002624 3300042601 Bacteria 3892
66 Ga0466714_137227 3300042603 Unclassified 1835
67 Ga0466719_052532 3300042606 Bacteria 2788
68 Ga0466722_266387 3300042609 Bacteria 22057
69 JGI24703J35330_11554715 3300002501 Bacteria 1236
70 Ga0072941_1157778 3300005201 Bacteria 1554
71 Ga0466697_145078 3300042611 Bacteria 2800
72 Ga0466693_308632 3300042592 Unclassified 3208
73 Ga0123355_11523057 3300009826 Unclassified 650
74 Ga0123356_10011510 3300010049 Bacteria 8621
75 Ga0123353_10598769 3300010167 Bacteria 1576
76 Ga0123353_11029080 3300010167 Bacteria 1103
77 Ga0123354_10270162 3300010882 Bacteria 1676
78 Ga0466734_054379 3300042623 Bacteria 1386
79 Ga0466709_180899 3300042648 Bacteria 11116
80 Ga0466724_07606 3300042649 Bacteria 33899
81 Ga0466711_010092 3300042615 Bacteria 2165
82 Ga0466714_042598 3300042603 Bacteria 7660
83 IMNBL1DRAFT_c0006096 3300000062 Bacteria 6697
84 JGI24696J40584_12928791 3300002834 Bacteria 1444
85 Ga0102739_1015175 3300007095 Unclassified 992
86 Ga0466732_390063 3300042656 Bacteria 3100
87 Ga0160452_104044 3300012834 Bacteria 2389
88 Ga0466657_015097 3300042582 Bacteria 157741
89 Ga0123355_10025167 3300009826 Bacteria 9581
90 Ga0123356_11056492 3300010049 Unclassified 981
91 Ga0123353_10000014 3300010167 Bacteria 204767
92 Ga0123353_10894215 3300010167 Bacteria 1210
93 Ga0466725_192127 3300042654 Bacteria 1207
94 Ga0466722_018550 3300042609 Bacteria 38972
95 IMNBL1DRAFT_c0179385 3300000062 Bacteria 535
96 CVPL010W_10002427 3300002931 Bacteria 48318
97 Ga0104045_1026879 3300007085 Bacteria 5274
98 Ga0104041_1117983 3300007106 Unclassified 1167
99 Ga0104044_1023493 3300007136 Bacteria 653
100 Ga0102740_1000604 3300007140 Unclassified 9816
101 Ga0466697_281117 3300042611 Bacteria 1520
102 Ga0160445_100491 3300012847 Bacteria 19562
103 Ga0160445_101295 3300012847 Bacteria 7397
104 Ga0456237_0007521 3300041968 Bacteria 1674
105 Ga0466695_255405 3300042595 Bacteria 1210
106 Ga0466696_184988 3300042596 Bacteria 2594
107 Ga0123357_10133160 3300009784 Bacteria 3085
108 Ga0123355_10006244 3300009826 Bacteria 17604
109 Ga0123355_10186530 3300009826 Bacteria 3065
110 Ga0123356_10125463 3300010049 Bacteria 2505
111 Ga0123356_11135245 3300010049 Bacteria 949
112 Ga0123356_11324613 3300010049 Bacteria 883
113 Ga0123356_11913883 3300010049 Bacteria 739
114 Ga0123353_10019146 3300010167 Bacteria 10157
115 Ga0123353_10377036 3300010167 Bacteria 2124
116 Ga0123353_10590236 3300010167 Bacteria 1591
117 Ga0466709_275063 3300042648 Bacteria 136526
118 Ga0466710_290726 3300042613 Bacteria 60149
119 Ga0466718_132302 3300042617 Bacteria 1275
120 Ga0466722_076941 3300042609 Bacteria 36712
121 Ga0072941_1635574 3300005201 Bacteria 970
122 Ga0104043_1097125 3300007058 Bacteria 814
123 Ga0102735_1000692 3300007080 Bacteria 8089
124 Ga0123357_10000183 3300009784 Bacteria 57952

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_052532 Ga0466719_052532_2039_2455 138
2 3300042643 Ga0466704_305892 Ga0466704_305892_3937_4353 138
3 3300010049 Ga0123356_11324613 Ga0123356_113246132 140
4 3300010167 Ga0123353_12005047 Ga0123353_120050471 140
5 3300042601 Ga0466707_002624 Ga0466707_002624_435_857 140
6 3300042609 Ga0466722_076941 Ga0466722_076941_17164_17592 142
7 3300042609 Ga0466722_215198 Ga0466722_215198_1055_1483 142
8 3300042609 Ga0466722_249625 Ga0466722_249625_6179_6607 142
9 3300042613 Ga0466710_290726 Ga0466710_290726_59185_59613 142
10 3300042617 Ga0466718_132302 Ga0466718_132302_330_758 142
11 iso_pr_bacteria 2843639003 2843639255 142
12 iso_pr_bacteria 2884500114 2884500366 142
13 iso_pr_bacteria 650716012 650926453 142
14 iso_pr_bacteria 2820573558 2820576295 143
15 3300042582 Ga0466657_088829 Ga0466657_088829_722_1156 144
16 3300042591 Ga0466692_025918 Ga0466692_025918_115_549 144
17 3300042592 Ga0466693_292622 Ga0466693_292622_470_904 144
18 3300042593 Ga0466691_077233 Ga0466691_077233_412_846 144
19 3300042595 Ga0466695_255405 Ga0466695_255405_157_591 144
20 3300042599 Ga0466706_257744 Ga0466706_257744_756_1190 144
21 3300042600 Ga0466700_160253 Ga0466700_160253_404_838 144
22 3300042605 Ga0466716_024070 Ga0466716_024070_2881_3315 144
23 3300042609 Ga0466722_018550 Ga0466722_018550_34938_35372 144
24 3300042648 Ga0466709_230390 Ga0466709_230390_331_765 144
25 3300042652 Ga0466708_120231 Ga0466708_120231_4733_5167 144
26 3300042654 Ga0466725_192127 Ga0466725_192127_745_1179 144
27 iso_pr_bacteria 2820848511 2820848659 144
28 iso_pr_bacteria 2820854745 2820854936 144
29 iso_pr_bacteria 2820870086 2820870300 144
30 iso_pr_bacteria 2820873081 2820873663 144
31 iso_pr_bacteria 2820880921 2820882084 144
32 iso_pr_bacteria 2820893114 2820893753 144
33 iso_pr_bacteria 2820907832 2820909328 144
34 iso_pr_bacteria 2820934415 2820935458 144
35 iso_pr_bacteria 2820942695 2820943645 144
36 iso_pr_bacteria 2821322763 2821323324 144
37 3300000062 IMNBL1DRAFT_c0179385 IMNBL1DRAFT_01793851 145
38 3300009784 Ga0123357_10088683 Ga0123357_100886833 145
39 3300009826 Ga0123355_10186530 Ga0123355_101865302 145
40 3300009826 Ga0123355_11523057 Ga0123355_115230572 145
41 3300010049 Ga0123356_10125463 Ga0123356_101254631 145
42 3300010049 Ga0123356_10218677 Ga0123356_102186773 145
43 3300010049 Ga0123356_11056492 Ga0123356_110564922 145
44 3300010049 Ga0123356_11420140 Ga0123356_114201402 145
45 3300010167 Ga0123353_10000181 Ga0123353_1000018114 145
46 3300010167 Ga0123353_10000803 Ga0123353_100008034 145
47 3300010167 Ga0123353_10007633 Ga0123353_100076338 145
48 3300010167 Ga0123353_10019902 Ga0123353_100199024 145
49 3300010167 Ga0123353_11029080 Ga0123353_110290802 145
50 3300010882 Ga0123354_10243830 Ga0123354_102438304 145
51 3300010882 Ga0123354_10270162 Ga0123354_102701623 145
52 iso_pr_bacteria 2820501819 2820502809 145
53 iso_pr_bacteria 2820856540 2820857351 145
54 3300000036 IMNBGM34_c011611 IMNBGM34_0116112 146
55 3300000062 IMNBL1DRAFT_c0006096 IMNBL1DRAFT_00060966 146
56 3300002501 JGI24703J35330_11554715 JGI24703J35330_115547153 146
57 3300009826 Ga0123355_10495843 Ga0123355_104958432 146
58 3300009826 Ga0123355_10994530 Ga0123355_109945301 146
59 3300010049 Ga0123356_11135245 Ga0123356_111352452 146
60 3300010049 Ga0123356_11492834 Ga0123356_114928341 146
61 3300010167 Ga0123353_10019146 Ga0123353_1001914611 146
62 3300042611 Ga0466697_145078 Ga0466697_145078_1376_1816 146
63 3300042611 Ga0466697_281117 Ga0466697_281117_818_1258 146
64 3300042643 Ga0466704_357125 Ga0466704_357125_14855_15295 146
65 3300009826 Ga0123355_10000146 Ga0123355_1000014652 147
66 3300009826 Ga0123355_10006244 Ga0123355_1000624418 147
67 3300009826 Ga0123355_10025167 Ga0123355_100251678 147
68 3300010167 Ga0123353_10083389 Ga0123353_100833894 147
69 3300010882 Ga0123354_10196624 Ga0123354_101966242 147
70 3300042598 Ga0466701_039882 Ga0466701_039882_99_542 147
71 3300042649 Ga0466724_07606 Ga0466724_07606_152_595 147
72 3300042649 Ga0466724_18033 Ga0466724_18033_2076_2519 147
73 iso_pr_bacteria 2579779088 2582236920 147
74 iso_pr_bacteria 2590828803 2592926991 147
75 iso_pr_bacteria 2820137450 2820138001 147
76 iso_pr_bacteria 2873776654 2873778266 147
77 iso_pr_bacteria 2896321640 2896323553 147
78 iso_pr_bacteria 2896330536 2896332063 147
79 iso_pr_bacteria 2896350215 2896351874 147
80 iso_pr_bacteria 2898741527 2898743792 147
81 3300002931 CVPL010W_10002427 CVPL010W_1000242734 148
82 3300005316 Ga0074302_1135926 Ga0074302_11359263 148
83 3300007058 Ga0104043_1097125 Ga0104043_10971252 148
84 3300007080 Ga0102735_1000692 Ga0102735_10006923 148
85 3300007085 Ga0104045_1000156 Ga0104045_10001564 148
86 3300007085 Ga0104045_1003360 Ga0104045_10033609 148
87 3300007085 Ga0104045_1026879 Ga0104045_102687910 148
88 3300007095 Ga0102739_1015175 Ga0102739_10151752 148
89 3300007106 Ga0104041_1032743 Ga0104041_10327434 148
90 3300007106 Ga0104041_1117983 Ga0104041_11179832 148
91 3300007129 Ga0102734_1001194 Ga0102734_10011948 148
92 3300007136 Ga0104044_1023493 Ga0104044_10234931 148
93 3300007140 Ga0102740_1000604 Ga0102740_100060410 148
94 3300010049 Ga0123356_10011510 Ga0123356_1001151010 148
95 3300012803 Ga0160465_100020 Ga0160465_100020157 148
96 3300012825 Ga0160441_100011 Ga0160441_100011191 148
97 3300012829 Ga0160467_100167 Ga0160467_10016785 148
98 3300012831 Ga0160459_107847 Ga0160459_1078473 148
99 3300012832 Ga0160458_100016 Ga0160458_10001614 148
100 3300012834 Ga0160452_104044 Ga0160452_1040444 148
101 3300012837 Ga0160455_106206 Ga0160455_1062061 148
102 3300012845 Ga0160460_100045 Ga0160460_100045103 148
103 3300012846 Ga0160433_100012 Ga0160433_10001284 148
104 3300012847 Ga0160445_100491 Ga0160445_1004915 148
105 3300012847 Ga0160445_101295 Ga0160445_1012953 148
106 3300012848 Ga0160443_100011 Ga0160443_10001155 148
107 3300012848 Ga0160443_100103 Ga0160443_10010384 148
108 3300012858 Ga0160457_1000010 Ga0160457_100001014 148
109 3300012858 Ga0160457_1002290 Ga0160457_10022903 148
110 3300009784 Ga0123357_10243837 Ga0123357_102438373 149
111 3300010049 Ga0123356_10050575 Ga0123356_100505751 149
112 3300042612 Ga0466705_052338 Ga0466705_052338_1815_2264 149
113 3300002834 JGI24696J40584_12928791 JGI24696J40584_129287912 150
114 3300042550 Ga0466656_048646 Ga0466656_048646_210_665 151
115 3300042582 Ga0466657_015097 Ga0466657_015097_18836_19291 151
116 3300042596 Ga0466696_184988 Ga0466696_184988_954_1409 151
117 3300042598 Ga0466701_089345 Ga0466701_089345_819_1274 151
118 3300042603 Ga0466714_042598 Ga0466714_042598_3025_3480 151
119 3300042603 Ga0466714_137227 Ga0466714_137227_181_636 151
120 3300042603 Ga0466714_144103 Ga0466714_144103_569_1024 151
121 3300042615 Ga0466711_010092 Ga0466711_010092_631_1086 151
122 3300042623 Ga0466734_054379 Ga0466734_054379_382_837 151
123 3300042623 Ga0466734_166224 Ga0466734_166224_211_666 151
124 3300042624 Ga0466735_051776 Ga0466735_051776_15889_16344 151
125 3300042648 Ga0466709_180899 Ga0466709_180899_2645_3100 151
126 3300042648 Ga0466709_275063 Ga0466709_275063_34026_34481 151
127 3300042656 Ga0466732_390063 Ga0466732_390063_104_559 151
128 iso_pr_bacteria 2820737921 2820738959 151
129 iso_pr_bacteria 2820768849 2820769594 151
130 iso_pr_bacteria 2820774381 2820775779 151
131 iso_pr_bacteria 637000113 638060657 151
132 3300002462 JGI24702J35022_10005736 JGI24702J35022_100057369 152
133 3300002834 JGI24696J40584_12681741 JGI24696J40584_126817411 152
134 3300005201 Ga0072941_1157778 Ga0072941_11577783 152
135 3300005201 Ga0072941_1635574 Ga0072941_16355742 152
136 3300009784 Ga0123357_10133160 Ga0123357_101331602 152
137 3300010049 Ga0123356_10129898 Ga0123356_101298982 152
138 3300010049 Ga0123356_11913883 Ga0123356_119138831 152
139 3300010167 Ga0123353_10000014 Ga0123353_10000014153 152
140 3300010167 Ga0123353_10377036 Ga0123353_103770363 152
141 3300010167 Ga0123353_10598769 Ga0123353_105987692 152
142 3300010167 Ga0123353_10894215 Ga0123353_108942151 152
143 3300042609 Ga0466722_266387 Ga0466722_266387_9048_9506 152
144 3300042612 Ga0466705_185215 Ga0466705_185215_16718_17179 153
145 3300009826 Ga0123355_11484703 Ga0123355_114847031 154
146 3300041968 Ga0456237_0007521 Ga0456237_0007521_413_880 155
147 3300010167 Ga0123353_10001046 Ga0123353_100010462 158
148 3300010167 Ga0123353_10590236 Ga0123353_105902361 162
149 3300042592 Ga0466693_308632 Ga0466693_308632_935_1429 164
150 iso_pr_bacteria 2820106212 2820107909 164
151 iso_pr_bacteria 2820111668 2820111731 164
152 3300009784 Ga0123357_10000022 Ga0123357_1000002264 165
153 3300009784 Ga0123357_10000183 Ga0123357_1000018335 165
154 3300012825 Ga0160441_100728 Ga0160441_10072813 166

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 36 153 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.