Protein Family IF03728
Metagenome
Isolate
179
Members
104
Samples
143
Scaffolds
315.85
Avg Length
Representative Sequence
- ID
- 3300012825|Ga0160441_100448|Ga0160441_10044827
- Length
- 359 aa
- Sequence
- MVFWIKGLFRELLTIFCLKNSSKYYGALLSFLPHFFTFAQSLKIMQEKIVVLGSNGQIGTELVTMLRKIYGDDHVVACDIRRPDYDIKNSAPFEFVNVLDKEMIKGIFQKYKPTQVYLLAALLSATGEQNPKLAWDLNMNGLLNVLDLALEYKTAKVYWPSSIAVYGPNSPKDHTAQYCIMDPNTVYGISKLAGERWCEYYHQKYGLDVRSIRYPGLISWKAAPGGGTTDYAIHIFHEALKKGSYQSFLNAETELPMMYMDDAIRGTIELMDAPANQISVRSSYNFAGVSFTPEVLAAEIRKHIPNFTLSYTNNDPRQQIANSWPRSIDDQYAAKDWGWKPEFDLSKLTIDMLNNLKK*
Sample Types
Isolate
20.1%
Metagenome
79.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.5%
Kalotermitidae
12.8%
Culicidae
9.6%
Formicidae
8.5%
Elmidae
7.4%
Unclassified
7.4%
Blattidae
6.4%
Armadillidiidae
4.3%
Rhinotermitidae
4.3%
Drosophilidae
3.2%
Termopsidae
3.2%
Passalidae
2.1%
Bombycidae
1.1%
Cambaridae
1.1%
Daphniidae
1.1%
Hydrophilidae
1.1%
Nephropidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 2 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 3 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 4 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 7 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 8 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 9 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 10 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 14 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 15 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 16 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 20 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 21 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 22 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 23 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 24 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 25 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 26 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 31 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 40 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 41 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 46 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 47 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 52 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 53 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 57 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 60 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 61 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 62 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 63 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 64 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 65 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 66 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 67 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 68 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 69 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 70 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 71 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 72 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 73 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 74 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 75 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 76 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 77 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 78 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 79 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 80 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 81 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 82 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 85 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 86 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 87 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 88 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 89 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 90 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 91 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 92 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 93 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 94 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 95 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 96 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 97 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 98 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 99 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 100 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 101 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 102 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 103 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 104 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_158935 | 3300042619 | Bacteria | 13251 |
| 2 | Ga0466726_177477 | 3300042619 | Bacteria | 11122 |
| 3 | Ga0466700_288800 | 3300042600 | Unclassified | 2213 |
| 4 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 5 | Ga0466721_160541 | 3300042608 | Bacteria | 27628 |
| 6 | Ga0160431_102402 | 3300012828 | Bacteria | 4415 |
| 7 | Ga0466694_239402 | 3300042594 | Bacteria | 2013 |
| 8 | Ga0466695_172732 | 3300042595 | Bacteria | 2692 |
| 9 | Ga0123357_10026192 | 3300009784 | Bacteria | 7875 |
| 10 | Ga0160464_100278 | 3300012805 | Bacteria | 47140 |
| 11 | Meta3P_1000731 | 3300002464 | Bacteria | 51610 |
| 12 | JGI24705J35276_12233391 | 3300002504 | Bacteria | 4819 |
| 13 | Ga0104045_1080302 | 3300007085 | Bacteria | 1211 |
| 14 | Ga0466734_010773 | 3300042623 | Bacteria | 1287 |
| 15 | Ga0466735_164752 | 3300042624 | Bacteria | 5074 |
| 16 | Ga0466724_25433 | 3300042649 | Bacteria | 649431 |
| 17 | Ga0466708_087448 | 3300042652 | Bacteria | 7594 |
| 18 | Ga0466708_117301 | 3300042652 | Bacteria | 8786 |
| 19 | Ga0466705_378642 | 3300042612 | Bacteria | 2561 |
| 20 | Ga0466710_002878 | 3300042613 | Bacteria | 1723 |
| 21 | Ga0466726_289978 | 3300042619 | Bacteria | 4336 |
| 22 | Ga0466701_057237 | 3300042598 | Bacteria | 162355 |
| 23 | Ga0466722_098653 | 3300042609 | Bacteria | 2248 |
| 24 | Ga0466722_208875 | 3300042609 | Bacteria | 6151 |
| 25 | Ga0160468_100090 | 3300012819 | Bacteria | 107635 |
| 26 | Ga0160469_100013 | 3300012824 | Bacteria | 444998 |
| 27 | Ga0160441_100448 | 3300012825 | Bacteria | 31752 |
| 28 | Ga0466696_249500 | 3300042596 | Bacteria | 3048 |
| 29 | Ga0123357_10292150 | 3300009784 | Bacteria | 1663 |
| 30 | 2227588808 | 2225789004 | Unclassified | 2440 |
| 31 | IMNBL1DRAFT_c0002679 | 3300000062 | Bacteria | 12170 |
| 32 | IMNBL1DRAFT_c0003960 | 3300000062 | Bacteria | 9152 |
| 33 | IMNBL1DRAFT_c0007894 | 3300000062 | Bacteria | 5509 |
| 34 | JGI24702J35022_10002816 | 3300002462 | Bacteria | 10546 |
| 35 | Ga0104050_1026557 | 3300007153 | Bacteria | 4552 |
| 36 | Ga0103267_1000018 | 3300007190 | Bacteria | 59730 |
| 37 | Ga0466729_306992 | 3300042621 | Bacteria | 3102 |
| 38 | Ga0466704_008789 | 3300042643 | Unclassified | 1573 |
| 39 | Ga0466709_176307 | 3300042648 | Bacteria | 46103 |
| 40 | Ga0466709_183787 | 3300042648 | Bacteria | 7491 |
| 41 | Ga0466708_060465 | 3300042652 | Bacteria | 14716 |
| 42 | Ga0466727_151884 | 3300042655 | Bacteria | 54336 |
| 43 | Ga0466727_220242 | 3300042655 | Bacteria | 12428 |
| 44 | Ga0466697_228209 | 3300042611 | Bacteria | 2018 |
| 45 | Ga0466715_320776 | 3300042616 | Bacteria | 30358 |
| 46 | Ga0466701_018147 | 3300042598 | Bacteria | 2396 |
| 47 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 48 | Ga0160448_100980 | 3300012854 | Bacteria | 9565 |
| 49 | Ga0466690_091597 | 3300042590 | Unclassified | 5618 |
| 50 | Ga0466692_041100 | 3300042591 | Bacteria | 2074 |
| 51 | Ga0123356_10130297 | 3300010049 | Bacteria | 2463 |
| 52 | Ga0123353_10142060 | 3300010167 | Bacteria | 3844 |
| 53 | Ga0123353_10798597 | 3300010167 | Bacteria | 1303 |
| 54 | Ga0123354_10239642 | 3300010882 | Unclassified | 1870 |
| 55 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 56 | Ga0102735_1002817 | 3300007080 | Bacteria | 2539 |
| 57 | Ga0104019_1004915 | 3300007150 | Bacteria | 2295 |
| 58 | Ga0466735_068011 | 3300042624 | Bacteria | 2549 |
| 59 | Ga0466704_195121 | 3300042643 | Bacteria | 2846 |
| 60 | Ga0466706_060088 | 3300042599 | Bacteria | 78068 |
| 61 | Ga0466706_237176 | 3300042599 | Bacteria | 4334 |
| 62 | Ga0160460_100125 | 3300012845 | Bacteria | 96320 |
| 63 | Ga0160433_100134 | 3300012846 | Bacteria | 65998 |
| 64 | Ga0160435_1000005 | 3300012857 | Bacteria | 359635 |
| 65 | Ga0466690_158332 | 3300042590 | Bacteria | 8518 |
| 66 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 67 | Ga0466692_177796 | 3300042591 | Unclassified | 1925 |
| 68 | Ga0466692_199099 | 3300042591 | Bacteria | 25136 |
| 69 | Ga0123355_10351469 | 3300009826 | Bacteria | 1952 |
| 70 | Ga0123356_10404062 | 3300010049 | Bacteria | 1504 |
| 71 | Ga0123354_10070133 | 3300010882 | Bacteria | 5073 |
| 72 | Ga0123354_10169762 | 3300010882 | Bacteria | 2545 |
| 73 | JGI24699J35502_11019501 | 3300002509 | Bacteria | 1443 |
| 74 | Ga0102736_1000068 | 3300007052 | Bacteria | 53396 |
| 75 | Ga0103267_1000896 | 3300007190 | Bacteria | 26851 |
| 76 | Ga0466735_069913 | 3300042624 | Bacteria | 19536 |
| 77 | Ga0466704_253255 | 3300042643 | Bacteria | 6841 |
| 78 | Ga0466704_271700 | 3300042643 | Bacteria | 14807 |
| 79 | Ga0466704_430109 | 3300042643 | Bacteria | 3747 |
| 80 | Ga0466709_125926 | 3300042648 | Bacteria | 10383 |
| 81 | Ga0466724_57866 | 3300042649 | Bacteria | 279776 |
| 82 | Ga0466697_218109 | 3300042611 | Unclassified | 1229 |
| 83 | Ga0466705_079333 | 3300042612 | Bacteria | 5684 |
| 84 | Ga0466733_025248 | 3300042659 | Bacteria | 4935 |
| 85 | Ga0466705_514413 | 3300042612 | Bacteria | 6780 |
| 86 | Ga0466710_250458 | 3300042613 | Unclassified | 1472 |
| 87 | Ga0466715_459271 | 3300042616 | Bacteria | 28994 |
| 88 | Ga0466723_143458 | 3300042618 | Bacteria | 13107 |
| 89 | Ga0466700_033238 | 3300042600 | Bacteria | 8542 |
| 90 | Ga0466700_368547 | 3300042600 | Bacteria | 21852 |
| 91 | Ga0160472_100182 | 3300012839 | Bacteria | 83517 |
| 92 | Ga0466696_045548 | 3300042596 | Bacteria | 4336 |
| 93 | Ga0123354_10024143 | 3300010882 | Bacteria | 9592 |
| 94 | Ga0103268_1000377 | 3300007192 | Bacteria | 14115 |
| 95 | Ga0466729_223727 | 3300042621 | Bacteria | 1269 |
| 96 | Ga0466704_066309 | 3300042643 | Bacteria | 57112 |
| 97 | Ga0466711_269359 | 3300042615 | Bacteria | 2724 |
| 98 | Ga0466729_130433 | 3300042621 | Bacteria | 3269 |
| 99 | Ga0466714_098535 | 3300042603 | Bacteria | 2394 |
| 100 | Ga0466716_291553 | 3300042605 | Bacteria | 12268 |
| 101 | Ga0160472_100044 | 3300012839 | Bacteria | 224512 |
| 102 | Ga0466692_003914 | 3300042591 | Bacteria | 8447 |
| 103 | Ga0466693_333363 | 3300042592 | Unclassified | 2621 |
| 104 | Ga0466691_003826 | 3300042593 | Unclassified | 12918 |
| 105 | Ga0123353_10318879 | 3300010167 | Bacteria | 2360 |
| 106 | Ga0123354_10087768 | 3300010882 | Bacteria | 4333 |
| 107 | JGI24702J35022_10046358 | 3300002462 | Bacteria | 2315 |
| 108 | CVPL010W_10000328 | 3300002931 | Bacteria | 47517 |
| 109 | Ga0068305_10027953 | 3300005083 | Bacteria | 12892 |
| 110 | Ga0466725_412714 | 3300042654 | Bacteria | 41724 |
| 111 | Ga0466710_264903 | 3300042613 | Bacteria | 1404 |
| 112 | Ga0466711_161125 | 3300042615 | Bacteria | 26115 |
| 113 | Ga0466723_086470 | 3300042618 | Bacteria | 6757 |
| 114 | Ga0466726_219540 | 3300042619 | Bacteria | 2733 |
| 115 | Ga0466726_340566 | 3300042619 | Bacteria | 5207 |
| 116 | Ga0466707_225904 | 3300042601 | Bacteria | 4001 |
| 117 | Ga0466713_118645 | 3300042602 | Bacteria | 113373 |
| 118 | Ga0466717_022483 | 3300042604 | Bacteria | 9356 |
| 119 | Ga0160472_100810 | 3300012839 | Bacteria | 13099 |
| 120 | Ga0466692_071759 | 3300042591 | Bacteria | 6280 |
| 121 | Ga0466696_133548 | 3300042596 | Bacteria | 2961 |
| 122 | Ga0123353_10045571 | 3300010167 | Bacteria | 6960 |
| 123 | Ga0103265_1000012 | 3300007068 | Bacteria | 38095 |
| 124 | Ga0102734_1000053 | 3300007129 | Bacteria | 36803 |
| 125 | Ga0103264_1000036 | 3300007188 | Bacteria | 135516 |
| 126 | Ga0103267_1000082 | 3300007190 | Bacteria | 35603 |
| 127 | Ga0466703_076072 | 3300042636 | Bacteria | 10705 |
| 128 | Ga0466703_199465 | 3300042636 | Bacteria | 1212 |
| 129 | Ga0466704_181687 | 3300042643 | Bacteria | 5578 |
| 130 | Ga0466705_187464 | 3300042612 | Bacteria | 12286 |
| 131 | Ga0466705_502823 | 3300042612 | Bacteria | 2068 |
| 132 | Ga0466711_445451 | 3300042615 | Bacteria | 12972 |
| 133 | Ga0466713_136787 | 3300042602 | Bacteria | 13136 |
| 134 | Ga0466696_500008 | 3300042596 | Bacteria | 1994 |
| 135 | Ga0123353_10833082 | 3300010167 | Bacteria | 1268 |
| 136 | Ga0123354_10036383 | 3300010882 | Bacteria | 7679 |
| 137 | JGI24702J35022_10000324 | 3300002462 | Bacteria | 28237 |
| 138 | Ga0104050_1003667 | 3300007153 | Bacteria | 3755 |
| 139 | Ga0103267_1001441 | 3300007190 | Bacteria | 5933 |
| 140 | Ga0466735_223067 | 3300042624 | Bacteria | 4536 |
| 141 | Ga0466730_092352 | 3300042625 | Bacteria | 3883 |
| 142 | Ga0466709_017802 | 3300042648 | Bacteria | 72752 |
| 143 | Ga0466727_322713 | 3300042655 | Bacteria | 1362 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10833082 | Ga0123353_108330822 | 282 |
| 2 | 3300042623 | Ga0466734_010773 | Ga0466734_010773_222_1178 | 289 |
| 3 | 3300010882 | Ga0123354_10239642 | Ga0123354_102396422 | 292 |
| 4 | 3300009826 | Ga0123355_10351469 | Ga0123355_103514692 | 294 |
| 5 | 3300010882 | Ga0123354_10070133 | Ga0123354_100701335 | 295 |
| 6 | 3300042613 | Ga0466710_002878 | Ga0466710_002878_166_1116 | 295 |
| 7 | 3300042643 | Ga0466704_008789 | Ga0466704_008789_579_1529 | 295 |
| 8 | 3300042602 | Ga0466713_136787 | Ga0466713_136787_633_1583 | 297 |
| 9 | 3300042619 | Ga0466726_219540 | Ga0466726_219540_837_1793 | 297 |
| 10 | 3300042648 | Ga0466709_183787 | Ga0466709_183787_2910_3863 | 297 |
| 11 | 3300002462 | JGI24702J35022_10046358 | JGI24702J35022_100463581 | 298 |
| 12 | 3300042590 | Ga0466690_091597 | Ga0466690_091597_3955_4905 | 298 |
| 13 | 3300042615 | Ga0466711_445451 | Ga0466711_445451_3815_4765 | 298 |
| 14 | 3300042643 | Ga0466704_066309 | Ga0466704_066309_38654_39625 | 298 |
| 15 | 3300042612 | Ga0466705_187464 | Ga0466705_187464_4309_5262 | 299 |
| 16 | 3300042618 | Ga0466723_086470 | Ga0466723_086470_458_1357 | 299 |
| 17 | 3300042618 | Ga0466723_143458 | Ga0466723_143458_2437_3387 | 299 |
| 18 | 3300042619 | Ga0466726_340566 | Ga0466726_340566_3516_4457 | 299 |
| 19 | 3300042636 | Ga0466703_199465 | Ga0466703_199465_44_943 | 299 |
| 20 | 3300042655 | Ga0466727_220242 | Ga0466727_220242_9843_10742 | 299 |
| 21 | 3300042612 | Ga0466705_378642 | Ga0466705_378642_1337_2308 | 300 |
| 22 | 3300042613 | Ga0466710_250458 | Ga0466710_250458_187_1143 | 301 |
| 23 | 3300010049 | Ga0123356_10404062 | Ga0123356_104040622 | 302 |
| 24 | 3300042655 | Ga0466727_322713 | Ga0466727_322713_222_1175 | 304 |
| 25 | 3300042619 | Ga0466726_289978 | Ga0466726_289978_1560_2513 | 305 |
| 26 | 3300042648 | Ga0466709_017802 | Ga0466709_017802_32334_33284 | 306 |
| 27 | 3300042643 | Ga0466704_181687 | Ga0466704_181687_442_1398 | 307 |
| 28 | 3300010167 | Ga0123353_10798597 | Ga0123353_107985972 | 310 |
| 29 | 3300010882 | Ga0123354_10036383 | Ga0123354_100363832 | 311 |
| 30 | 3300042592 | Ga0466693_333363 | Ga0466693_333363_1675_2610 | 311 |
| 31 | 3300007080 | Ga0102735_1002817 | Ga0102735_10028173 | 314 |
| 32 | 3300012839 | Ga0160472_100044 | Ga0160472_100044150 | 314 |
| 33 | 3300042643 | Ga0466704_195121 | Ga0466704_195121_1029_1973 | 314 |
| 34 | 3300042652 | Ga0466708_117301 | Ga0466708_117301_144_1088 | 314 |
| 35 | iso_pr_bacteria | 2873776654 | 2873777541 | 314 |
| 36 | 2225789004 | 2227588808 | 2228145968 | 315 |
| 37 | 3300002931 | CVPL010W_10000328 | CVPL010W_1000032820 | 315 |
| 38 | 3300007190 | Ga0103267_1000896 | Ga0103267_100089618 | 315 |
| 39 | 3300010049 | Ga0123356_10130297 | Ga0123356_101302972 | 315 |
| 40 | 3300010167 | Ga0123353_10318879 | Ga0123353_103188792 | 315 |
| 41 | 3300010882 | Ga0123354_10024143 | Ga0123354_1002414310 | 315 |
| 42 | 3300010882 | Ga0123354_10087768 | Ga0123354_100877682 | 315 |
| 43 | 3300012824 | Ga0160469_100013 | Ga0160469_10001358 | 315 |
| 44 | 3300012828 | Ga0160431_102402 | Ga0160431_1024023 | 315 |
| 45 | 3300012839 | Ga0160472_100810 | Ga0160472_1008102 | 315 |
| 46 | 3300012857 | Ga0160435_1000005 | Ga0160435_1000005274 | 315 |
| 47 | 3300042594 | Ga0466694_239402 | Ga0466694_239402_406_1353 | 315 |
| 48 | 3300042599 | Ga0466706_060088 | Ga0466706_060088_54667_55614 | 315 |
| 49 | 3300042621 | Ga0466729_223727 | Ga0466729_223727_205_1152 | 315 |
| 50 | 3300042621 | Ga0466729_306992 | Ga0466729_306992_1054_2001 | 315 |
| 51 | 3300042636 | Ga0466703_076072 | Ga0466703_076072_7689_8636 | 315 |
| 52 | 3300042648 | Ga0466709_176307 | Ga0466709_176307_27558_28505 | 315 |
| 53 | 3300042652 | Ga0466708_087448 | Ga0466708_087448_4873_5820 | 315 |
| 54 | iso_pr_bacteria | 2590828803 | 2592928634 | 315 |
| 55 | iso_pr_bacteria | 2820737921 | 2820737940 | 315 |
| 56 | iso_pr_bacteria | 2940216256 | 2940216859 | 315 |
| 57 | iso_pr_bacteria | 8100166142 | 8100169357 | 315 |
| 58 | 3300000062 | IMNBL1DRAFT_c0003960 | IMNBL1DRAFT_00039602 | 316 |
| 59 | 3300002462 | JGI24702J35022_10000324 | JGI24702J35022_1000032419 | 316 |
| 60 | 3300007068 | Ga0103265_1000012 | Ga0103265_10000126 | 316 |
| 61 | 3300007150 | Ga0104019_1004915 | Ga0104019_10049153 | 316 |
| 62 | 3300007153 | Ga0104050_1026557 | Ga0104050_10265573 | 316 |
| 63 | 3300012805 | Ga0160464_100278 | Ga0160464_10027841 | 316 |
| 64 | 3300012845 | Ga0160460_100125 | Ga0160460_10012536 | 316 |
| 65 | 3300042590 | Ga0466690_158332 | Ga0466690_158332_2523_3473 | 316 |
| 66 | 3300042591 | Ga0466692_199099 | Ga0466692_199099_17133_18083 | 316 |
| 67 | 3300042593 | Ga0466691_003826 | Ga0466691_003826_11172_12122 | 316 |
| 68 | 3300042596 | Ga0466696_045548 | Ga0466696_045548_3020_3970 | 316 |
| 69 | 3300042596 | Ga0466696_249500 | Ga0466696_249500_1395_2345 | 316 |
| 70 | 3300042598 | Ga0466701_018147 | Ga0466701_018147_26_976 | 316 |
| 71 | 3300042601 | Ga0466707_225904 | Ga0466707_225904_2367_3317 | 316 |
| 72 | 3300042605 | Ga0466716_291553 | Ga0466716_291553_8438_9388 | 316 |
| 73 | 3300042609 | Ga0466722_098653 | Ga0466722_098653_756_1706 | 316 |
| 74 | 3300042612 | Ga0466705_502823 | Ga0466705_502823_806_1756 | 316 |
| 75 | 3300042612 | Ga0466705_514413 | Ga0466705_514413_1265_2215 | 316 |
| 76 | 3300042613 | Ga0466710_264903 | Ga0466710_264903_228_1178 | 316 |
| 77 | 3300042616 | Ga0466715_320776 | Ga0466715_320776_14611_15561 | 316 |
| 78 | 3300042619 | Ga0466726_177477 | Ga0466726_177477_4352_5302 | 316 |
| 79 | 3300042621 | Ga0466729_130433 | Ga0466729_130433_856_1806 | 316 |
| 80 | 3300042624 | Ga0466735_068011 | Ga0466735_068011_1123_2073 | 316 |
| 81 | 3300042624 | Ga0466735_164752 | Ga0466735_164752_3478_4428 | 316 |
| 82 | 3300042624 | Ga0466735_223067 | Ga0466735_223067_2941_3891 | 316 |
| 83 | 3300042643 | Ga0466704_271700 | Ga0466704_271700_7762_8712 | 316 |
| 84 | 3300042643 | Ga0466704_430109 | Ga0466704_430109_1639_2589 | 316 |
| 85 | 3300042655 | Ga0466727_151884 | Ga0466727_151884_11894_12844 | 316 |
| 86 | iso_pr_bacteria | 2579779088 | 2582237415 | 316 |
| 87 | iso_pr_bacteria | 2579779088 | 2582239976 | 316 |
| 88 | iso_pr_bacteria | 2896321640 | 2896324871 | 316 |
| 89 | iso_pr_bacteria | 2896330536 | 2896333318 | 316 |
| 90 | iso_pr_bacteria | 2896350215 | 2896353353 | 316 |
| 91 | iso_pr_bacteria | 2898741527 | 2898744456 | 316 |
| 92 | 3300000062 | IMNBL1DRAFT_c0007894 | IMNBL1DRAFT_00078942 | 317 |
| 93 | 3300005083 | Ga0068305_10027953 | Ga0068305_100279533 | 317 |
| 94 | 3300007129 | Ga0102734_1000053 | Ga0102734_100005325 | 317 |
| 95 | 3300007153 | Ga0104050_1003667 | Ga0104050_10036673 | 317 |
| 96 | 3300042591 | Ga0466692_119633 | Ga0466692_119633_80246_81199 | 317 |
| 97 | 3300042596 | Ga0466696_500008 | Ga0466696_500008_760_1713 | 317 |
| 98 | 3300042611 | Ga0466697_228209 | Ga0466697_228209_512_1465 | 317 |
| 99 | 3300042619 | Ga0466726_158935 | Ga0466726_158935_222_1175 | 317 |
| 100 | 3300042643 | Ga0466704_253255 | Ga0466704_253255_2068_3021 | 317 |
| 101 | 3300042648 | Ga0466709_125926 | Ga0466709_125926_9128_10081 | 317 |
| 102 | iso_pr_bacteria | 2882250448 | 2882250638 | 317 |
| 103 | iso_pr_bacteria | 2998907766 | 2998908102 | 317 |
| 104 | 3300007190 | Ga0103267_1000018 | Ga0103267_100001810 | 318 |
| 105 | 3300007190 | Ga0103267_1000082 | Ga0103267_100008217 | 318 |
| 106 | 3300007192 | Ga0103268_1000377 | Ga0103268_10003777 | 318 |
| 107 | 3300010167 | Ga0123353_10045571 | Ga0123353_100455715 | 318 |
| 108 | 3300010882 | Ga0123354_10169762 | Ga0123354_101697622 | 318 |
| 109 | 3300012846 | Ga0160433_100134 | Ga0160433_10013439 | 318 |
| 110 | 3300042595 | Ga0466695_172732 | Ga0466695_172732_1214_2170 | 318 |
| 111 | 3300042600 | Ga0466700_368547 | Ga0466700_368547_12944_13900 | 318 |
| 112 | 3300042609 | Ga0466722_208875 | Ga0466722_208875_1608_2564 | 318 |
| 113 | iso_pr_bacteria | 2695420314 | 2695472087 | 318 |
| 114 | iso_pr_bacteria | 2820759988 | 2820761509 | 318 |
| 115 | 3300000062 | IMNBL1DRAFT_c0002679 | IMNBL1DRAFT_00026798 | 319 |
| 116 | 3300002509 | JGI24699J35502_11019501 | JGI24699J35502_110195012 | 319 |
| 117 | 3300009784 | Ga0123357_10026192 | Ga0123357_100261922 | 319 |
| 118 | 3300042591 | Ga0466692_041100 | Ga0466692_041100_167_1126 | 319 |
| 119 | 3300042599 | Ga0466706_237176 | Ga0466706_237176_1252_2211 | 319 |
| 120 | 3300042600 | Ga0466700_033238 | Ga0466700_033238_897_1856 | 319 |
| 121 | 3300042602 | Ga0466713_091714 | Ga0466713_091714_141662_142621 | 319 |
| 122 | 3300042604 | Ga0466717_022483 | Ga0466717_022483_3257_4216 | 319 |
| 123 | 3300042615 | Ga0466711_161125 | Ga0466711_161125_4486_5445 | 319 |
| 124 | 3300042616 | Ga0466715_459271 | Ga0466715_459271_7304_8263 | 319 |
| 125 | 3300042659 | Ga0466733_025248 | Ga0466733_025248_341_1300 | 319 |
| 126 | iso_pr_bacteria | 2910926975 | 2910927989 | 319 |
| 127 | iso_pr_bacteria | 2940244548 | 2940245200 | 319 |
| 128 | iso_pr_bacteria | 2940248789 | 2940249440 | 319 |
| 129 | iso_pr_bacteria | 2940253009 | 2940253550 | 319 |
| 130 | iso_pr_bacteria | 2940257232 | 2940257405 | 319 |
| 131 | iso_pr_bacteria | 8100166142 | 8100166257 | 319 |
| 132 | 3300009784 | Ga0123357_10292150 | Ga0123357_102921502 | 320 |
| 133 | 3300042602 | Ga0466713_118645 | Ga0466713_118645_3359_4321 | 320 |
| 134 | 3300042603 | Ga0466714_098535 | Ga0466714_098535_139_1101 | 320 |
| 135 | 3300042615 | Ga0466711_269359 | Ga0466711_269359_1029_1991 | 320 |
| 136 | 3300042624 | Ga0466735_069913 | Ga0466735_069913_17728_18690 | 320 |
| 137 | 3300042625 | Ga0466730_092352 | Ga0466730_092352_99_1061 | 320 |
| 138 | iso_pr_bacteria | 2718218155 | 2720329983 | 320 |
| 139 | iso_pr_bacteria | 2820762746 | 2820764971 | 320 |
| 140 | iso_pr_bacteria | 2864755708 | 2864757028 | 320 |
| 141 | iso_pr_bacteria | 2864891731 | 2864892125 | 320 |
| 142 | iso_pr_bacteria | 2921902974 | 2921903670 | 320 |
| 143 | 3300002509 | JGI24699J35502_11134211 | JGI24699J35502_1113421127 | 321 |
| 144 | 3300007052 | Ga0102736_1000068 | Ga0102736_100006823 | 321 |
| 145 | 3300007188 | Ga0103264_1000036 | Ga0103264_100003682 | 321 |
| 146 | 3300007190 | Ga0103267_1001441 | Ga0103267_10014417 | 321 |
| 147 | 3300042591 | Ga0466692_071759 | Ga0466692_071759_2832_3797 | 321 |
| 148 | 3300042598 | Ga0466701_057237 | Ga0466701_057237_10907_11872 | 321 |
| 149 | 3300042649 | Ga0466724_57866 | Ga0466724_57866_16765_17730 | 321 |
| 150 | 3300042654 | Ga0466725_412714 | Ga0466725_412714_10906_11871 | 321 |
| 151 | iso_pr_bacteria | 2864822740 | 2864824225 | 321 |
| 152 | iso_pr_bacteria | 2864882932 | 2864883456 | 321 |
| 153 | 3300002462 | JGI24702J35022_10002816 | JGI24702J35022_100028163 | 322 |
| 154 | 3300002504 | JGI24705J35276_12233391 | JGI24705J35276_122333912 | 322 |
| 155 | 3300007085 | Ga0104045_1080302 | Ga0104045_10803021 | 322 |
| 156 | 3300042649 | Ga0466724_25433 | Ga0466724_25433_576942_577910 | 322 |
| 157 | iso_pr_bacteria | 2529292732 | 2529760785 | 322 |
| 158 | iso_pr_bacteria | 2847090942 | 2847094726 | 322 |
| 159 | iso_pr_bacteria | 2864788197 | 2864790096 | 322 |
| 160 | iso_pr_bacteria | 2864923010 | 2864924909 | 322 |
| 161 | iso_pr_bacteria | 2864948220 | 2864949272 | 322 |
| 162 | iso_pr_bacteria | 8020009074 | 8020009538 | 322 |
| 163 | iso_pr_bacteria | 8114076984 | 8114077193 | 322 |
| 164 | 3300002464 | Meta3P_1000731 | Meta3P_100073128 | 323 |
| 165 | iso_pr_bacteria | 2838772460 | 2838773837 | 324 |
| 166 | 3300012819 | Ga0160468_100090 | Ga0160468_10009027 | 325 |
| 167 | 3300042596 | Ga0466696_133548 | Ga0466696_133548_571_1551 | 326 |
| 168 | 3300042591 | Ga0466692_003914 | Ga0466692_003914_217_1200 | 327 |
| 169 | 3300042612 | Ga0466705_079333 | Ga0466705_079333_3811_4848 | 327 |
| 170 | 3300012837 | Ga0160455_100062 | Ga0160455_100062156 | 329 |
| 171 | 3300012839 | Ga0160472_100182 | Ga0160472_10018255 | 329 |
| 172 | 3300042611 | Ga0466697_218109 | Ga0466697_218109_120_1112 | 330 |
| 173 | 3300012854 | Ga0160448_100980 | Ga0160448_1009804 | 333 |
| 174 | 3300042591 | Ga0466692_177796 | Ga0466692_177796_451_1455 | 334 |
| 175 | 3300042600 | Ga0466700_288800 | Ga0466700_288800_431_1438 | 335 |
| 176 | 3300042608 | Ga0466721_160541 | Ga0466721_160541_19642_20649 | 335 |
| 177 | 3300042652 | Ga0466708_060465 | Ga0466708_060465_1430_2440 | 336 |
| 178 | 3300010167 | Ga0123353_10142060 | Ga0123353_101420602 | 348 |
| 179 | 3300012825 | Ga0160441_100448 | Ga0160441_10044827 | 359 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 48 | 204 | 0.89 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 50 | 174 | 0.87 |
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 49 | 277 | 0.86 |
| PF07993 | NAD_binding_4 | Male sterility protein | 132 | 261 | 0.86 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 51 | 213 | 0.81 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.