Protein Family IF03678
Metagenome
Isolate
212
Members
127
Samples
144
Scaffolds
569.7
Avg Length
Representative Sequence
- ID
- 3300012818|Ga0160432_100004|Ga0160432_100004192
- Length
- 612 aa
- Sequence
- MGDWNRREWIKVVGMSALGTVVGLRKLGLDASSVKYIDGELYIPRAKYVALFGPTTGDKVRLADTELFIEIEKDFAVYGEENKFGGGKTIRDGMGQSARALGDEGVLDFCITNVIVIDHWGIVKGDVGIKSGKIVGVGKAGNPDVQDGVSEGMIIGASTEVHSGAGMILTAGGIDTHIHFISPQQVETALYSGVTTFIGGGTGPADGSNATTVTSGKWYIEKMLQAFETLPINVGIFGKGNVSTMRPIEEMVEAGALGVKIHEDWGATPVTIDTALKVADKYDVQVAIHSDTLNEAGFLEDTVRAIDGRVIHTFHTEGAGGGHAPDIIKIAMYPNILPASTNPTKPYTVNTAEEHLDMLMVCHHLDKNVKEDVAFADSRIRPQTIAAEDILQDMGVFSIMSSDSQAMGRVGEVISRTFQTAHKMKIQRGPLKEDEGSGNDNFRVKRYVSKYTINPAKAHGIDTYVGSIEPGKYADLILWKAEMFGVKPELIIKGGMILGAKMGDINASIPTPQPIVYRMMFGNYGKALSNICYNFVSKISLENGSIKKMGLSRTSLPVKGCRTVMKKDMVHNNATPDITVDPETYDVKVDGVIATCEPLAVLPMAQRYFLF*
Sample Types
Isolate
32.1%
Metagenome
67.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
32.8%
Termitidae
11.8%
Unclassified
10.9%
Kalotermitidae
9.2%
Tenebrionidae
5.0%
Rhinotermitidae
4.2%
Blattidae
3.4%
Drosophilidae
3.4%
Culicidae
2.5%
Elmidae
1.7%
Armadillidiidae
1.7%
Pyralidae
1.7%
Formicidae
1.7%
Bombycidae
1.7%
Hydrophilidae
1.7%
Daphniidae
0.8%
Siricidae
0.8%
Noctuidae
0.8%
Anthocoridae
0.8%
Cixiidae
0.8%
Termopsidae
0.8%
Curculionidae
0.8%
Muscidae
0.8%
Taxonomy
Archaea
0
Bacteria
183
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 3 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 4 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 5 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 6 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 7 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 8 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 9 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 16 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 17 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 18 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 19 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 20 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 28 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 29 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 30 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 31 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 32 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 33 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 34 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 35 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 36 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 37 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 38 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 41 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 42 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 43 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 44 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 45 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 48 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 49 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 50 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 55 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 56 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 57 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 58 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 59 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 60 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 63 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 64 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 67 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 68 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 69 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 70 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 71 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 72 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 73 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 74 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 75 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 76 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 77 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 78 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 82 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 83 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 84 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 85 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 86 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 87 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 88 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 89 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 90 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 91 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 92 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 93 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 94 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 95 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 96 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 97 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 98 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 99 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 100 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 101 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 102 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 103 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 104 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 105 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 106 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 107 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 108 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 109 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 110 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 111 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 112 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 113 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 114 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 115 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 116 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 117 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 118 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 119 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 120 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 121 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 122 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 123 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 124 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 125 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 126 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 127 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_197395 | 3300042612 | Bacteria | 16742 |
| 2 | Ga0562379_0166 | 3300056790 | Unclassified | 195826 |
| 3 | Ga0562377_0074 | 3300056842 | Bacteria | 389509 |
| 4 | Ga0562374_0212 | 3300057007 | Bacteria | 123353 |
| 5 | Ga0160432_100004 | 3300012818 | Bacteria | 604772 |
| 6 | Ga0466692_191449 | 3300042591 | Bacteria | 2738 |
| 7 | Ga0466699_322043 | 3300042597 | Bacteria | 20531 |
| 8 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 9 | Ga0466703_218677 | 3300042636 | Bacteria | 6553 |
| 10 | Ga0466704_483366 | 3300042643 | Bacteria | 2210 |
| 11 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 12 | Ga0123355_10022372 | 3300009826 | Bacteria | 10133 |
| 13 | Ga0160442_100019 | 3300012806 | Unclassified | 338988 |
| 14 | Ga0466705_389991 | 3300042612 | Bacteria | 2888 |
| 15 | Ga0466715_160590 | 3300042616 | Bacteria | 34416 |
| 16 | Ga0466726_383822 | 3300042619 | Bacteria | 6498 |
| 17 | Ga0466728_025305 | 3300042620 | Bacteria | 11300 |
| 18 | Ga0466728_199156 | 3300042620 | Bacteria | 4079 |
| 19 | Ga0466707_030407 | 3300042601 | Bacteria | 4251 |
| 20 | Ga0466707_275623 | 3300042601 | Bacteria | 12682 |
| 21 | Ga0466719_230873 | 3300042606 | Unclassified | 5598 |
| 22 | Ga0466722_022870 | 3300042609 | Bacteria | 9131 |
| 23 | Ga0466705_082319 | 3300042612 | Bacteria | 39236 |
| 24 | Ga0562376_5137 | 3300056857 | Bacteria | 9237 |
| 25 | Ga0264413_100354 | 3300024493 | Bacteria | 36172 |
| 26 | Ga0255572_1000007 | 3300026175 | Bacteria | 235375 |
| 27 | Ga0466692_177203 | 3300042591 | Bacteria | 2585 |
| 28 | Ga0466696_048471 | 3300042596 | Bacteria | 12607 |
| 29 | Ga0466703_411528 | 3300042636 | Bacteria | 5702 |
| 30 | Ga0466724_22604 | 3300042649 | Bacteria | 3437 |
| 31 | Ga0466708_396804 | 3300042652 | Bacteria | 4776 |
| 32 | Ga0160466_103110 | 3300012809 | Unclassified | 2887 |
| 33 | Ga0466712_093008 | 3300042614 | Unclassified | 12110 |
| 34 | Ga0466712_109181 | 3300042614 | Unclassified | 8855 |
| 35 | Ga0466711_102528 | 3300042615 | Bacteria | 24279 |
| 36 | Ga0466715_421496 | 3300042616 | Bacteria | 13769 |
| 37 | Ga0466726_122054 | 3300042619 | Bacteria | 5609 |
| 38 | Ga0466728_277988 | 3300042620 | Bacteria | 2962 |
| 39 | Ga0466719_322226 | 3300042606 | Bacteria | 5324 |
| 40 | Ga0466733_083610 | 3300042659 | Bacteria | 33057 |
| 41 | Ga0160453_100006 | 3300012814 | Bacteria | 353163 |
| 42 | Ga0160455_101856 | 3300012837 | Bacteria | 5317 |
| 43 | Ga0466699_146945 | 3300042597 | Bacteria | 6776 |
| 44 | Ga0466730_048395 | 3300042625 | Bacteria | 298700 |
| 45 | Ga0466703_135593 | 3300042636 | Bacteria | 14337 |
| 46 | Ga0466703_234815 | 3300042636 | Bacteria | 52704 |
| 47 | Ga0466704_246960 | 3300042643 | Bacteria | 12341 |
| 48 | Ga0466704_526888 | 3300042643 | Bacteria | 3037 |
| 49 | Ga0466724_02720 | 3300042649 | Bacteria | 247008 |
| 50 | JGI24698J34947_10008820 | 3300002449 | Unclassified | 5533 |
| 51 | Ga0072941_1000834 | 3300005201 | Bacteria | 15800 |
| 52 | Ga0072941_1000837 | 3300005201 | Unclassified | 6951 |
| 53 | Ga0466707_138798 | 3300042601 | Bacteria | 3187 |
| 54 | Ga0466719_255482 | 3300042606 | Bacteria | 15289 |
| 55 | Ga0562377_0042 | 3300056842 | Bacteria | 605479 |
| 56 | Ga0562375_0500 | 3300056856 | Bacteria | 80617 |
| 57 | Ga0562374_0045 | 3300057007 | Unclassified | 593659 |
| 58 | Ga0562374_2154 | 3300057007 | Bacteria | 18761 |
| 59 | Ga0466699_028381 | 3300042597 | Bacteria | 4693 |
| 60 | Ga0466701_004279 | 3300042598 | Bacteria | 4061 |
| 61 | Ga0466730_009837 | 3300042625 | Bacteria | 325641 |
| 62 | Ga0466724_02699 | 3300042649 | Bacteria | 72032 |
| 63 | Ga0466724_06985 | 3300042649 | Bacteria | 79949 |
| 64 | Ga0466711_497723 | 3300042615 | Bacteria | 12246 |
| 65 | Ga0466723_137817 | 3300042618 | Bacteria | 12808 |
| 66 | SWWA_contig10526__length_3474___numreads_53 | 2100351016 | Unclassified | 3474 |
| 67 | Meta3P_1002895 | 3300002464 | Bacteria | 10278 |
| 68 | Ga0072941_1000836 | 3300005201 | Unclassified | 8716 |
| 69 | Ga0466707_288168 | 3300042601 | Bacteria | 17797 |
| 70 | Ga0466713_012949 | 3300042602 | Bacteria | 10359 |
| 71 | Ga0562379_3076 | 3300056790 | Unclassified | 11975 |
| 72 | Ga0562377_0422 | 3300056842 | Unclassified | 74000 |
| 73 | Ga0160459_100706 | 3300012831 | Bacteria | 11415 |
| 74 | Ga0466703_222557 | 3300042636 | Bacteria | 4302 |
| 75 | Ga0466724_57068 | 3300042649 | Unclassified | 23272 |
| 76 | Ga0466723_045798 | 3300042618 | Bacteria | 21643 |
| 77 | Ga0466729_081394 | 3300042621 | Bacteria | 28662 |
| 78 | Ga0466729_154008 | 3300042621 | Bacteria | 3076 |
| 79 | SCG598P14_112480 | 3300000479 | Bacteria | 63944 |
| 80 | JGI24698J34947_10021638 | 3300002449 | Unclassified | 3455 |
| 81 | Ga0063521_1000536 | 3300003973 | Bacteria | 16785 |
| 82 | Ga0074308_1018377 | 3300005307 | Unclassified | 2950 |
| 83 | Ga0104045_1002681 | 3300007085 | Unclassified | 8153 |
| 84 | Ga0104041_1032544 | 3300007106 | Bacteria | 4319 |
| 85 | Ga0466707_307560 | 3300042601 | Bacteria | 8840 |
| 86 | Ga0466716_125208 | 3300042605 | Bacteria | 4436 |
| 87 | Ga0466720_034181 | 3300042607 | Bacteria | 7208 |
| 88 | Ga0466720_041454 | 3300042607 | Unclassified | 2573 |
| 89 | Ga0466705_167570 | 3300042612 | Bacteria | 8922 |
| 90 | Ga0530661_000002 | 3300056564 | Bacteria | 530532 |
| 91 | Ga0562376_0142 | 3300056857 | Bacteria | 157622 |
| 92 | Ga0562376_0698 | 3300056857 | Unclassified | 55752 |
| 93 | Ga0562376_1508 | 3300056857 | Bacteria | 32235 |
| 94 | Ga0160467_100956 | 3300012829 | Bacteria | 16461 |
| 95 | Ga0466699_048800 | 3300042597 | Bacteria | 7156 |
| 96 | Ga0466704_621043 | 3300042643 | Bacteria | 6215 |
| 97 | Ga0160454_100061 | 3300012798 | Bacteria | 156776 |
| 98 | Ga0466712_259166 | 3300042614 | Unclassified | 4790 |
| 99 | Ga0466711_226211 | 3300042615 | Bacteria | 2747 |
| 100 | Ga0466723_178974 | 3300042618 | Bacteria | 3655 |
| 101 | Ga0466728_044962 | 3300042620 | Bacteria | 9767 |
| 102 | Ga0466728_056335 | 3300042620 | Bacteria | 48636 |
| 103 | SCG598J21_11619 | 3300000475 | Unclassified | 30466 |
| 104 | JGI24698J34947_10001579 | 3300002449 | Bacteria | 12072 |
| 105 | JGI24700J35501_10930615 | 3300002508 | Bacteria | 16789 |
| 106 | Ga0063521_1000001 | 3300003973 | Bacteria | 444973 |
| 107 | Ga0466707_032911 | 3300042601 | Bacteria | 2112 |
| 108 | Ga0466713_059288 | 3300042602 | Bacteria | 171779 |
| 109 | Ga0466714_004981 | 3300042603 | Bacteria | 11484 |
| 110 | Ga0466722_170661 | 3300042609 | Bacteria | 22453 |
| 111 | Ga0562379_0513 | 3300056790 | Unclassified | 77111 |
| 112 | Ga0562377_0239 | 3300056842 | Bacteria | 130157 |
| 113 | Ga0562376_1461 | 3300056857 | Unclassified | 33158 |
| 114 | Ga0562374_0193 | 3300057007 | Unclassified | 131220 |
| 115 | Ga0562374_1213 | 3300057007 | Unclassified | 32214 |
| 116 | Ga0466696_090559 | 3300042596 | Bacteria | 28933 |
| 117 | Ga0466699_068378 | 3300042597 | Bacteria | 23608 |
| 118 | Ga0466729_205722 | 3300042621 | Bacteria | 3453 |
| 119 | Ga0466708_200914 | 3300042652 | Bacteria | 3543 |
| 120 | Ga0466723_002933 | 3300042618 | Bacteria | 27474 |
| 121 | Ga0466723_239629 | 3300042618 | Bacteria | 3482 |
| 122 | SCG598O02_11502 | 3300000460 | Bacteria | 56074 |
| 123 | Ga0072940_1132259 | 3300005200 | Bacteria | 21206 |
| 124 | Ga0072941_1000839 | 3300005201 | Unclassified | 10266 |
| 125 | Ga0104019_1000403 | 3300007150 | Bacteria | 7671 |
| 126 | Ga0466705_049732 | 3300042612 | Unclassified | 6654 |
| 127 | Ga0466705_254218 | 3300042612 | Bacteria | 15568 |
| 128 | Ga0466705_282345 | 3300042612 | Bacteria | 11843 |
| 129 | Ga0562374_0164 | 3300057007 | Unclassified | 152696 |
| 130 | Ga0160453_100037 | 3300012814 | Bacteria | 166272 |
| 131 | Ga0160472_100607 | 3300012839 | Unclassified | 19798 |
| 132 | Ga0264413_106741 | 3300024493 | Bacteria | 5101 |
| 133 | Ga0466693_424045 | 3300042592 | Bacteria | 2153 |
| 134 | Ga0466701_006539 | 3300042598 | Bacteria | 166094 |
| 135 | Ga0466703_116026 | 3300042636 | Bacteria | 4405 |
| 136 | Ga0466704_294219 | 3300042643 | Bacteria | 55450 |
| 137 | Ga0160464_100171 | 3300012805 | Bacteria | 69359 |
| 138 | Ga0466726_019594 | 3300042619 | Bacteria | 10896 |
| 139 | Ga0466728_136946 | 3300042620 | Bacteria | 8947 |
| 140 | Ga0466701_032874 | 3300042598 | Bacteria | 41464 |
| 141 | Ga0466701_068877 | 3300042598 | Bacteria | 86362 |
| 142 | Ga0466707_018711 | 3300042601 | Bacteria | 29522 |
| 143 | Ga0466707_081421 | 3300042601 | Bacteria | 7880 |
| 144 | Ga0466713_013162 | 3300042602 | Bacteria | 27722 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300056842 | Ga0562377_0239 | Ga0562377_0239_127846_129345 | 499 |
| 2 | 3300057007 | Ga0562374_0193 | Ga0562374_0193_17343_19079 | 533 |
| 3 | 3300056790 | Ga0562379_0166 | Ga0562379_0166_121194_122930 | 534 |
| 4 | 3300056790 | Ga0562379_0513 | Ga0562379_0513_42839_44575 | 534 |
| 5 | 3300056856 | Ga0562375_0500 | Ga0562375_0500_65110_66846 | 534 |
| 6 | 3300056857 | Ga0562376_1461 | Ga0562376_1461_9029_10765 | 534 |
| 7 | 3300042620 | Ga0466728_277988 | Ga0466728_277988_124_1797 | 535 |
| 8 | 3300056857 | Ga0562376_5137 | Ga0562376_5137_1799_3436 | 545 |
| 9 | 3300009826 | Ga0123355_10022372 | Ga0123355_100223723 | 547 |
| 10 | 3300042601 | Ga0466707_307560 | Ga0466707_307560_656_2368 | 547 |
| 11 | 3300012805 | Ga0160464_100171 | Ga0160464_10017156 | 549 |
| 12 | 3300042616 | Ga0466715_421496 | Ga0466715_421496_7626_9275 | 549 |
| 13 | 3300042649 | Ga0466724_02720 | Ga0466724_02720_50003_51718 | 549 |
| 14 | 3300042605 | Ga0466716_125208 | Ga0466716_125208_619_2325 | 552 |
| 15 | 3300042607 | Ga0466720_041454 | Ga0466720_041454_16_1728 | 552 |
| 16 | 3300042609 | Ga0466722_170661 | Ga0466722_170661_265_1938 | 557 |
| 17 | 3300003973 | Ga0063521_1000536 | Ga0063521_10005368 | 559 |
| 18 | 3300024493 | Ga0264413_100354 | Ga0264413_10035422 | 559 |
| 19 | 3300042601 | Ga0466707_030407 | Ga0466707_030407_85_1764 | 559 |
| 20 | 3300042614 | Ga0466712_109181 | Ga0466712_109181_3400_5079 | 559 |
| 21 | 3300042619 | Ga0466726_122054 | Ga0466726_122054_1168_2847 | 559 |
| 22 | 3300042643 | Ga0466704_483366 | Ga0466704_483366_151_1830 | 559 |
| 23 | 3300042652 | Ga0466708_396804 | Ga0466708_396804_2439_4145 | 559 |
| 24 | 3300042592 | Ga0466693_424045 | Ga0466693_424045_374_2056 | 560 |
| 25 | 3300042612 | Ga0466705_282345 | Ga0466705_282345_8596_10278 | 560 |
| 26 | 3300042636 | Ga0466703_234815 | Ga0466703_234815_15208_16914 | 560 |
| 27 | 3300042606 | Ga0466719_230873 | Ga0466719_230873_3763_5448 | 561 |
| 28 | 3300042636 | Ga0466703_411528 | Ga0466703_411528_2640_4325 | 561 |
| 29 | 3300026175 | Ga0255572_1000007 | Ga0255572_100000725 | 563 |
| 30 | 3300042601 | Ga0466707_275623 | Ga0466707_275623_5985_7685 | 566 |
| 31 | 3300042620 | Ga0466728_044962 | Ga0466728_044962_2762_4462 | 566 |
| 32 | iso_pr_bacteria | 643886087 | 644668653 | 566 |
| 33 | 3300042601 | Ga0466707_018711 | Ga0466707_018711_24447_26150 | 567 |
| 34 | 3300042601 | Ga0466707_138798 | Ga0466707_138798_882_2585 | 567 |
| 35 | 3300042612 | Ga0466705_082319 | Ga0466705_082319_24496_26199 | 567 |
| 36 | 3300042612 | Ga0466705_167570 | Ga0466705_167570_1167_2870 | 567 |
| 37 | 3300042619 | Ga0466726_019594 | Ga0466726_019594_2327_4030 | 567 |
| 38 | 3300042620 | Ga0466728_199156 | Ga0466728_199156_1416_3119 | 567 |
| 39 | iso_pr_bacteria | 2528768159 | 2529054006 | 567 |
| 40 | iso_pr_bacteria | 2617270844 | 2617733880 | 567 |
| 41 | iso_pr_bacteria | 8067483258 | 8067486818 | 567 |
| 42 | 3300012814 | Ga0160453_100006 | Ga0160453_100006169 | 568 |
| 43 | 3300012831 | Ga0160459_100706 | Ga0160459_1007065 | 568 |
| 44 | 3300012839 | Ga0160472_100607 | Ga0160472_10060711 | 568 |
| 45 | 3300042606 | Ga0466719_322226 | Ga0466719_322226_31_1737 | 568 |
| 46 | 3300042618 | Ga0466723_045798 | Ga0466723_045798_2865_4571 | 568 |
| 47 | 3300042618 | Ga0466723_137817 | Ga0466723_137817_4787_6493 | 568 |
| 48 | 3300042618 | Ga0466723_178974 | Ga0466723_178974_1158_2864 | 568 |
| 49 | 3300042621 | Ga0466729_081394 | Ga0466729_081394_24451_26157 | 568 |
| 50 | iso_pr_bacteria | 2511231129 | 2511730860 | 568 |
| 51 | iso_pr_bacteria | 2556921669 | 2558279532 | 568 |
| 52 | iso_pr_bacteria | 2989309576 | 2989312883 | 568 |
| 53 | 3300042597 | Ga0466699_028381 | Ga0466699_028381_2563_4272 | 569 |
| 54 | 3300042597 | Ga0466699_048800 | Ga0466699_048800_787_2496 | 569 |
| 55 | 3300042597 | Ga0466699_068378 | Ga0466699_068378_12481_14190 | 569 |
| 56 | 3300042597 | Ga0466699_146945 | Ga0466699_146945_2228_3937 | 569 |
| 57 | 3300042597 | Ga0466699_322043 | Ga0466699_322043_10210_11919 | 569 |
| 58 | 3300042620 | Ga0466728_056335 | Ga0466728_056335_29981_31690 | 569 |
| 59 | 3300012837 | Ga0160455_101856 | Ga0160455_1018562 | 570 |
| 60 | 3300024493 | Ga0264413_106741 | Ga0264413_1067413 | 570 |
| 61 | 3300042602 | Ga0466713_013162 | Ga0466713_013162_6910_8622 | 570 |
| 62 | 3300042607 | Ga0466720_034181 | Ga0466720_034181_3989_5701 | 570 |
| 63 | 3300042612 | Ga0466705_197395 | Ga0466705_197395_1734_3446 | 570 |
| 64 | 3300042614 | Ga0466712_093008 | Ga0466712_093008_9368_11080 | 570 |
| 65 | 3300042614 | Ga0466712_259166 | Ga0466712_259166_1972_3684 | 570 |
| 66 | 3300042615 | Ga0466711_102528 | Ga0466711_102528_18624_20336 | 570 |
| 67 | 3300042615 | Ga0466711_226211 | Ga0466711_226211_127_1839 | 570 |
| 68 | 3300042616 | Ga0466715_160590 | Ga0466715_160590_3501_5213 | 570 |
| 69 | 3300042619 | Ga0466726_383822 | Ga0466726_383822_1192_2904 | 570 |
| 70 | iso_pr_bacteria | 2563367190 | 2565785672 | 570 |
| 71 | iso_pr_bacteria | 2864981449 | 2864982133 | 570 |
| 72 | iso_pr_bacteria | 2890957088 | 2890961680 | 570 |
| 73 | iso_pr_bacteria | 2940264388 | 2940266190 | 570 |
| 74 | iso_pr_bacteria | 2940267548 | 2940269425 | 570 |
| 75 | iso_pr_bacteria | 2940270707 | 2940272584 | 570 |
| 76 | iso_pr_bacteria | 2940273867 | 2940275751 | 570 |
| 77 | 2100351016 | SWWA_contig10526__length_3474___numreads_53 | SWWA_01500470 | 571 |
| 78 | 3300002449 | JGI24698J34947_10001579 | JGI24698J34947_100015796 | 571 |
| 79 | 3300002449 | JGI24698J34947_10008820 | JGI24698J34947_100088206 | 571 |
| 80 | 3300002449 | JGI24698J34947_10021638 | JGI24698J34947_100216382 | 571 |
| 81 | 3300005200 | Ga0072940_1132259 | Ga0072940_113225910 | 571 |
| 82 | 3300005201 | Ga0072941_1000834 | Ga0072941_100083418 | 571 |
| 83 | 3300005201 | Ga0072941_1000836 | Ga0072941_10008369 | 571 |
| 84 | 3300005201 | Ga0072941_1000837 | Ga0072941_10008375 | 571 |
| 85 | 3300005201 | Ga0072941_1000839 | Ga0072941_100083911 | 571 |
| 86 | 3300012814 | Ga0160453_100037 | Ga0160453_10003716 | 571 |
| 87 | 3300042591 | Ga0466692_177203 | Ga0466692_177203_763_2478 | 571 |
| 88 | 3300042596 | Ga0466696_048471 | Ga0466696_048471_1374_3089 | 571 |
| 89 | 3300042601 | Ga0466707_288168 | Ga0466707_288168_11632_13347 | 571 |
| 90 | 3300042615 | Ga0466711_497723 | Ga0466711_497723_2432_4147 | 571 |
| 91 | 3300042643 | Ga0466704_621043 | Ga0466704_621043_2622_4337 | 571 |
| 92 | 3300056790 | Ga0562379_3076 | Ga0562379_3076_9145_10860 | 571 |
| 93 | 3300056842 | Ga0562377_0074 | Ga0562377_0074_143591_145306 | 571 |
| 94 | 3300056857 | Ga0562376_1508 | Ga0562376_1508_29392_31107 | 571 |
| 95 | 3300057007 | Ga0562374_0045 | Ga0562374_0045_17836_19551 | 571 |
| 96 | 3300057007 | Ga0562374_0164 | Ga0562374_0164_113458_115173 | 571 |
| 97 | iso_pr_bacteria | 2524614537 | 2524834431 | 571 |
| 98 | iso_pr_bacteria | 2651870110 | 2653795719 | 571 |
| 99 | iso_pr_bacteria | 2864985977 | 2864986438 | 571 |
| 100 | iso_pr_bacteria | 2996406003 | 2996408409 | 571 |
| 101 | 3300002464 | Meta3P_1002895 | Meta3P_100289511 | 572 |
| 102 | 3300042596 | Ga0466696_090559 | Ga0466696_090559_10122_11840 | 572 |
| 103 | 3300042601 | Ga0466707_032911 | Ga0466707_032911_212_1930 | 572 |
| 104 | 3300042601 | Ga0466707_081421 | Ga0466707_081421_4788_6506 | 572 |
| 105 | 3300042606 | Ga0466719_255482 | Ga0466719_255482_5395_7113 | 572 |
| 106 | 3300042609 | Ga0466722_022870 | Ga0466722_022870_6510_8228 | 572 |
| 107 | 3300042612 | Ga0466705_254218 | Ga0466705_254218_7966_9684 | 572 |
| 108 | 3300042612 | Ga0466705_389991 | Ga0466705_389991_255_1973 | 572 |
| 109 | 3300042620 | Ga0466728_136946 | Ga0466728_136946_2607_4325 | 572 |
| 110 | 3300042621 | Ga0466729_205722 | Ga0466729_205722_136_1854 | 572 |
| 111 | 3300042636 | Ga0466703_116026 | Ga0466703_116026_1928_3646 | 572 |
| 112 | 3300042636 | Ga0466703_135593 | Ga0466703_135593_2690_4408 | 572 |
| 113 | 3300042636 | Ga0466703_218677 | Ga0466703_218677_2724_4442 | 572 |
| 114 | 3300042636 | Ga0466703_222557 | Ga0466703_222557_843_2561 | 572 |
| 115 | 3300042643 | Ga0466704_246960 | Ga0466704_246960_2300_4018 | 572 |
| 116 | 3300042643 | Ga0466704_294219 | Ga0466704_294219_47025_48743 | 572 |
| 117 | 3300042643 | Ga0466704_526888 | Ga0466704_526888_103_1821 | 572 |
| 118 | 3300042652 | Ga0466708_200914 | Ga0466708_200914_1012_2730 | 572 |
| 119 | iso_pr_bacteria | 2529293168 | 2531456562 | 572 |
| 120 | iso_pr_bacteria | 2724678956 | 2724788873 | 572 |
| 121 | iso_pr_bacteria | 2781125694 | 2781436334 | 572 |
| 122 | iso_pr_bacteria | 2870361953 | 2870362541 | 572 |
| 123 | 3300002508 | JGI24700J35501_10930615 | JGI24700J35501_109306158 | 573 |
| 124 | 3300003973 | Ga0063521_1000001 | Ga0063521_1000001155 | 573 |
| 125 | 3300007085 | Ga0104045_1002681 | Ga0104045_10026815 | 573 |
| 126 | 3300007150 | Ga0104019_1000403 | Ga0104019_10004037 | 573 |
| 127 | 3300042598 | Ga0466701_004279 | Ga0466701_004279_1938_3659 | 573 |
| 128 | 3300042598 | Ga0466701_006539 | Ga0466701_006539_44698_46419 | 573 |
| 129 | 3300042598 | Ga0466701_068877 | Ga0466701_068877_42220_43941 | 573 |
| 130 | 3300042602 | Ga0466713_059288 | Ga0466713_059288_53768_55489 | 573 |
| 131 | 3300042603 | Ga0466714_004981 | Ga0466714_004981_7114_8835 | 573 |
| 132 | 3300042612 | Ga0466705_049732 | Ga0466705_049732_3717_5438 | 573 |
| 133 | 3300042625 | Ga0466730_039992 | Ga0466730_039992_841287_843008 | 573 |
| 134 | 3300042625 | Ga0466730_048395 | Ga0466730_048395_46526_48247 | 573 |
| 135 | 3300042649 | Ga0466724_02699 | Ga0466724_02699_25438_27159 | 573 |
| 136 | 3300042649 | Ga0466724_22604 | Ga0466724_22604_466_2187 | 573 |
| 137 | 3300042649 | Ga0466724_43696 | Ga0466724_43696_25473_27194 | 573 |
| 138 | 3300042659 | Ga0466733_083610 | Ga0466733_083610_11129_12850 | 573 |
| 139 | 3300057007 | Ga0562374_2154 | Ga0562374_2154_14858_16579 | 573 |
| 140 | iso_pr_bacteria | 2571042003 | 2571062616 | 573 |
| 141 | iso_pr_bacteria | 2585427850 | 2586974546 | 573 |
| 142 | iso_pr_bacteria | 2585427851 | 2586976781 | 573 |
| 143 | iso_pr_bacteria | 2585428136 | 2588037488 | 573 |
| 144 | iso_pr_bacteria | 2684622927 | 2686106353 | 573 |
| 145 | iso_pr_bacteria | 2687453786 | 2690170929 | 573 |
| 146 | iso_pr_bacteria | 2695420317 | 2695483395 | 573 |
| 147 | iso_pr_bacteria | 2811994808 | 2812042763 | 573 |
| 148 | iso_pr_bacteria | 2854084220 | 2854086419 | 573 |
| 149 | iso_pr_bacteria | 2854086477 | 2854087047 | 573 |
| 150 | iso_pr_bacteria | 2854088767 | 2854089250 | 573 |
| 151 | iso_pr_bacteria | 2854091108 | 2854091401 | 573 |
| 152 | iso_pr_bacteria | 2854093395 | 2854093676 | 573 |
| 153 | iso_pr_bacteria | 2854095577 | 2854097725 | 573 |
| 154 | iso_pr_bacteria | 2854097802 | 2854098824 | 573 |
| 155 | iso_pr_bacteria | 2854100132 | 2854102213 | 573 |
| 156 | iso_pr_bacteria | 2854102457 | 2854102729 | 573 |
| 157 | iso_pr_bacteria | 2854104879 | 2854106417 | 573 |
| 158 | iso_pr_bacteria | 2857822956 | 2857824676 | 573 |
| 159 | iso_pr_bacteria | 2857825141 | 2857826115 | 573 |
| 160 | iso_pr_bacteria | 2857830159 | 2857831889 | 573 |
| 161 | iso_pr_bacteria | 2857832487 | 2857834705 | 573 |
| 162 | iso_pr_bacteria | 2857835046 | 2857837086 | 573 |
| 163 | iso_pr_bacteria | 2857840086 | 2857841609 | 573 |
| 164 | iso_pr_bacteria | 2857842411 | 2857842615 | 573 |
| 165 | iso_pr_bacteria | 2857845033 | 2857846637 | 573 |
| 166 | iso_pr_bacteria | 2868461634 | 2868462117 | 573 |
| 167 | iso_pr_bacteria | 2868464004 | 2868464755 | 573 |
| 168 | iso_pr_bacteria | 2873600114 | 2873600213 | 573 |
| 169 | iso_pr_bacteria | 2873610414 | 2873610586 | 573 |
| 170 | iso_pr_bacteria | 8100157865 | 8100159769 | 573 |
| 171 | iso_pr_bacteria | 8101255641 | 8101257267 | 573 |
| 172 | iso_pr_bacteria | 8101258116 | 8101259665 | 573 |
| 173 | iso_pr_bacteria | 8101260589 | 8101262203 | 573 |
| 174 | iso_pr_bacteria | 8101263066 | 8101263198 | 573 |
| 175 | iso_pr_bacteria | 8101265296 | 8101267578 | 573 |
| 176 | iso_pr_bacteria | 8101267702 | 8101269567 | 573 |
| 177 | iso_pr_bacteria | 8101270055 | 8101271496 | 573 |
| 178 | iso_pr_bacteria | 8101272231 | 8101273677 | 573 |
| 179 | iso_pr_bacteria | 8101274435 | 8101276249 | 573 |
| 180 | iso_pr_bacteria | 8101276651 | 8101278465 | 573 |
| 181 | iso_pr_bacteria | 8101278866 | 8101280765 | 573 |
| 182 | iso_pr_bacteria | 8119099601 | 8119099990 | 573 |
| 183 | 3300000460 | SCG598O02_11502 | SCG598O02_1150245 | 574 |
| 184 | 3300000475 | SCG598J21_11619 | SCG598J21_1161924 | 574 |
| 185 | 3300000479 | SCG598P14_112480 | SCG598P14_11248028 | 574 |
| 186 | 3300005307 | Ga0074308_1018377 | Ga0074308_10183773 | 574 |
| 187 | 3300007106 | Ga0104041_1032544 | Ga0104041_10325444 | 574 |
| 188 | 3300012798 | Ga0160454_100061 | Ga0160454_10006118 | 574 |
| 189 | 3300042602 | Ga0466713_012949 | Ga0466713_012949_6500_8224 | 574 |
| 190 | 3300042618 | Ga0466723_002933 | Ga0466723_002933_5385_7109 | 574 |
| 191 | 3300042618 | Ga0466723_239629 | Ga0466723_239629_1094_2821 | 575 |
| 192 | 3300042620 | Ga0466728_025305 | Ga0466728_025305_3119_4846 | 575 |
| 193 | 3300042621 | Ga0466729_154008 | Ga0466729_154008_95_1822 | 575 |
| 194 | 3300056564 | Ga0530661_000002 | Ga0530661_000002_247887_249614 | 575 |
| 195 | 3300056842 | Ga0562377_0422 | Ga0562377_0422_53717_55444 | 575 |
| 196 | 3300056857 | Ga0562376_0142 | Ga0562376_0142_153722_155449 | 575 |
| 197 | 3300056857 | Ga0562376_0698 | Ga0562376_0698_3517_5244 | 575 |
| 198 | 3300057007 | Ga0562374_0212 | Ga0562374_0212_19404_21131 | 575 |
| 199 | 3300057007 | Ga0562374_1213 | Ga0562374_1213_12614_14341 | 575 |
| 200 | 3300042591 | Ga0466692_191449 | Ga0466692_191449_278_2011 | 577 |
| 201 | 3300056842 | Ga0562377_0042 | Ga0562377_0042_451494_453233 | 579 |
| 202 | 3300012806 | Ga0160442_100019 | Ga0160442_100019230 | 583 |
| 203 | 3300012829 | Ga0160467_100956 | Ga0160467_10095613 | 583 |
| 204 | iso_pr_bacteria | 2537562000 | 2539434884 | 590 |
| 205 | iso_pr_bacteria | 8061039349 | 8061040352 | 590 |
| 206 | iso_pr_bacteria | 8061045771 | 8061049363 | 590 |
| 207 | 3300042649 | Ga0466724_57068 | Ga0466724_57068_15483_17333 | 593 |
| 208 | 3300042598 | Ga0466701_032874 | Ga0466701_032874_15590_17440 | 594 |
| 209 | 3300042625 | Ga0466730_009837 | Ga0466730_009837_202281_204131 | 594 |
| 210 | 3300042649 | Ga0466724_06985 | Ga0466724_06985_1963_3813 | 594 |
| 211 | 3300012809 | Ga0160466_103110 | Ga0160466_1031103 | 612 |
| 212 | 3300012818 | Ga0160432_100004 | Ga0160432_100004192 | 612 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01979 | GO:0016787 | hydrolase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.94 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.