Protein Family IF03667

Metagenome Isolate
134 Members
73 Samples
112 Scaffolds
229 Avg Length

🧬 Representative Sequence

ID
3300012814|Ga0160453_100350|Ga0160453_10035032
Length
262 aa
Sequence
MKLSLENIKEGRMNMANLVEQNLTTLRREMELACLASGREISEVKLLLATKTVPLEKLQLALQVGETLFGENKVQELRDKFPLMQQYNQLEWHFIGHLQTNKVKDVVKYVTLIHSVDRLKLGQVLHQYLLKENKTMDILVQVNTSCEESKFGISPQSVLELVDQLSQFDKLNIKGLMTIGKLGATNEETRQCFRRLKQLQTQIIEKKFPRVQMDILSMGMSGDFKIAIEEGATIIRVGTSIFGERYLPDEYYWNENANQNE*

📊 Sample Types

Isolate 16.4%
Metagenome 83.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.7%
Kalotermitidae 20.0%
Unclassified 17.1%
Blattidae 11.4%
Rhinotermitidae 2.9%
Termopsidae 2.9%
Apidae 1.4%
Passalidae 1.4%
Armadillidiidae 1.4%
Hydrophilidae 1.4%
Culicidae 1.4%
Noctuidae 1.4%
Drosophilidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
2 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
12 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
13 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
20 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
21 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
22 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
45 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
46 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
49 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
50 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
51 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
52 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
53 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
54 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
55 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
59 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
60 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
61 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
62 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
63 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
64 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
65 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
70 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
71 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_256487 3300042612 Bacteria 125039
2 Ga0466733_201141 3300042659 Bacteria 8038
3 Ga0123354_10262068 3300010882 Bacteria 1723
4 Ga0466703_393525 3300042636 Bacteria 72819
5 Ga0466704_091891 3300042643 Bacteria 6166
6 Ga0466707_129172 3300042601 Bacteria 4139
7 Ga0466714_000287 3300042603 Bacteria 5423
8 Ga0466717_011444 3300042604 Bacteria 2458
9 Ga0466719_368744 3300042606 Bacteria 25583
10 Ga0466722_183668 3300042609 Bacteria 4823
11 Ga0466690_389304 3300042590 Bacteria 3314
12 Ga0466705_458442 3300042612 Bacteria 7090
13 Ga0466710_021228 3300042613 Bacteria 41506
14 Ga0466723_217856 3300042618 Bacteria 8531
15 Ga0466723_271571 3300042618 Bacteria 1151
16 Ga0466728_104651 3300042620 Bacteria 4240
17 Ga0466729_166579 3300042621 Bacteria 2394
18 IMNBGM34_c000689 3300000036 Bacteria 8137
19 JGI24702J35022_10018107 3300002462 Bacteria 3844
20 Ga0072940_1065882 3300005200 Bacteria 3930
21 Ga0105005_1025498 3300007505 Bacteria 5607
22 Ga0123357_10000836 3300009784 Bacteria 31243
23 Ga0466705_273242 3300042612 Bacteria 11729
24 Ga0123356_10293995 3300010049 Bacteria 1726
25 Ga0123356_11013585 3300010049 Bacteria 1000
26 Ga0123353_10392137 3300010167 Bacteria 2071
27 Ga0466701_035767 3300042598 Bacteria 128967
28 Ga0466719_076075 3300042606 Bacteria 3441
29 Ga0466721_184634 3300042608 Bacteria 2122
30 Ga0466722_072401 3300042609 Bacteria 13246
31 Ga0466698_315075 3300042610 Bacteria 1975
32 Ga0160453_100350 3300012814 Bacteria 39506
33 Ga0415639_195224 3300038395 Bacteria 4030
34 Ga0466705_500814 3300042612 Bacteria 28836
35 Ga0466711_453482 3300042615 Bacteria 1302
36 Ga0466723_235996 3300042618 Bacteria 8944
37 Ga0123355_10055601 3300009826 Bacteria 6407
38 Ga0123356_10038738 3300010049 Bacteria 4441
39 Ga0123353_10358355 3300010167 Bacteria 2193
40 Ga0160466_100934 3300012809 Bacteria 10353
41 Ga0466731_434012 3300042622 Bacteria 1501
42 Ga0466735_058344 3300042624 Bacteria 1501
43 Ga0466708_062858 3300042652 Bacteria 11796
44 Ga0466716_349587 3300042605 Bacteria 1713
45 Ga0466726_219540 3300042619 Bacteria 2733
46 Ga0466728_481466 3300042620 Bacteria 1359
47 Ga0466697_092531 3300042611 Bacteria 1779
48 Ga0466705_118471 3300042612 Bacteria 5323
49 Ga0123355_10000089 3300009826 Bacteria 96529
50 Ga0123353_10173715 3300010167 Bacteria 3418
51 Ga0466709_292477 3300042648 Bacteria 5578
52 Ga0466700_440816 3300042600 Bacteria 1848
53 Ga0466717_162587 3300042604 Bacteria 3917
54 Ga0466716_092166 3300042605 Bacteria 1468
55 Ga0466723_077295 3300042618 Bacteria 10580
56 JGI24698J34947_10010929 3300002449 Bacteria 4980
57 JGI24698J34947_10080195 3300002449 Unclassified 1534
58 JGI24695J34938_10049270 3300002450 Bacteria 1852
59 JGI24702J35022_10001828 3300002462 Bacteria 13099
60 Ga0466732_365083 3300042656 Bacteria 3466
61 Ga0123355_10000005 3300009826 Bacteria 212958
62 Ga0123356_10591041 3300010049 Bacteria 1274
63 Ga0466703_045996 3300042636 Bacteria 4598
64 Ga0466701_079905 3300042598 Bacteria 1449
65 Ga0466714_004323 3300042603 Bacteria 16717
66 Ga0466722_010481 3300042609 Bacteria 1823
67 Ga0160445_100580 3300012847 Bacteria 16258
68 Ga0160448_110718 3300012854 Bacteria 1915
69 Ga0415639_029080 3300038395 Unclassified 4569
70 Ga0466696_020333 3300042596 Bacteria 15336
71 Ga0466718_064991 3300042617 Unclassified 2228
72 Ga0123357_10001422 3300009784 Bacteria 25377
73 Ga0466735_118102 3300042624 Bacteria 26562
74 Ga0466703_246048 3300042636 Bacteria 6181
75 Ga0466704_594161 3300042643 Bacteria 15028
76 Ga0466707_088010 3300042601 Bacteria 5232
77 Ga0466722_190607 3300042609 Bacteria 13141
78 Ga0466698_385525 3300042610 Bacteria 4026
79 Ga0415639_139949 3300038395 Bacteria 1780
80 Ga0466691_051496 3300042593 Bacteria 20198
81 Ga0466715_225720 3300042616 Bacteria 14185
82 Ga0466718_020883 3300042617 Bacteria 1644
83 Ga0466723_098598 3300042618 Bacteria 2666
84 Ga0466723_250433 3300042618 Bacteria 5758
85 Ga0466723_344666 3300042618 Bacteria 4482
86 Ga0466705_383677 3300042612 Bacteria 2682
87 Ga0123353_10165189 3300010167 Bacteria 3519
88 Ga0466700_238039 3300042600 Bacteria 3628
89 Ga0466657_016832 3300042582 Bacteria 2273
90 Ga0466690_137464 3300042590 Bacteria 4247
91 Ga0466693_374623 3300042592 Bacteria 1306
92 Ga0466705_481115 3300042612 Bacteria 54627
93 Ga0466715_099998 3300042616 Bacteria 20690
94 Ga0466715_279396 3300042616 Bacteria 2038
95 Ga0466715_285516 3300042616 Bacteria 10439
96 Ga0466723_043308 3300042618 Bacteria 6343
97 Ga0466723_287335 3300042618 Bacteria 21779
98 Ga0466723_367555 3300042618 Bacteria 11651
99 Ga0466726_340762 3300042619 Bacteria 3788
100 Ga0466729_215809 3300042621 Bacteria 18744
101 Ga0466707_027215 3300042601 Bacteria 11213
102 Ga0466714_168878 3300042603 Bacteria 2734
103 Ga0466716_252663 3300042605 Bacteria 3291
104 Ga0264413_129381 3300024493 Bacteria 4481
105 Ga0415639_119889 3300038395 Bacteria 1285
106 Ga0466691_065340 3300042593 Bacteria 14409
107 Ga0466705_413959 3300042612 Bacteria 23585
108 Ga0466715_547104 3300042616 Bacteria 25033
109 Ga0466723_052549 3300042618 Bacteria 12057
110 JGI24702J35022_10204535 3300002462 Bacteria 1131
111 JGI24705J35276_12231989 3300002504 Bacteria 4139
112 Ga0123357_10000352 3300009784 Bacteria 43511

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10262068 Ga0123354_102620682 189
2 3300002449 JGI24698J34947_10010929 JGI24698J34947_100109294 201
3 3300010167 Ga0123353_10165189 Ga0123353_101651894 205
4 3300042618 Ga0466723_077295 Ga0466723_077295_9384_10013 209
5 3300042618 Ga0466723_344666 Ga0466723_344666_3647_4276 209
6 3300042592 Ga0466693_374623 Ga0466693_374623_257_946 210
7 3300042609 Ga0466722_183668 Ga0466722_183668_3090_3722 210
8 3300042612 Ga0466705_413959 Ga0466705_413959_3288_3923 211
9 3300009784 Ga0123357_10000836 Ga0123357_100008366 213
10 3300042612 Ga0466705_500814 Ga0466705_500814_15282_15926 214
11 3300009784 Ga0123357_10000352 Ga0123357_1000035215 215
12 3300042618 Ga0466723_250433 Ga0466723_250433_4073_4765 216
13 3300042659 Ga0466733_201141 Ga0466733_201141_3281_3982 216
14 3300024493 Ga0264413_129381 Ga0264413_1293812 218
15 3300042604 Ga0466717_162587 Ga0466717_162587_2938_3594 218
16 3300042610 Ga0466698_315075 Ga0466698_315075_583_1281 218
17 iso_pr_bacteria 2820753519 2820754565 218
18 iso_pr_bacteria 2820755292 2820756475 218
19 3300042616 Ga0466715_225720 Ga0466715_225720_3023_3682 219
20 3300042621 Ga0466729_215809 Ga0466729_215809_2605_3264 219
21 3300042622 Ga0466731_434012 Ga0466731_434012_808_1467 219
22 3300042606 Ga0466719_076075 Ga0466719_076075_1062_1724 220
23 3300042608 Ga0466721_184634 Ga0466721_184634_763_1428 221
24 3300042619 Ga0466726_219540 Ga0466726_219540_181_846 221
25 3300042621 Ga0466729_166579 Ga0466729_166579_1373_2077 221
26 3300002462 JGI24702J35022_10001828 JGI24702J35022_100018288 222
27 3300009826 Ga0123355_10000089 Ga0123355_1000008962 223
28 3300010167 Ga0123353_10173715 Ga0123353_101737152 223
29 3300042593 Ga0466691_065340 Ga0466691_065340_2435_3106 223
30 3300042609 Ga0466722_190607 Ga0466722_190607_9843_10514 223
31 3300042620 Ga0466728_104651 Ga0466728_104651_2919_3590 223
32 3300042636 Ga0466703_045996 Ga0466703_045996_1906_2577 223
33 3300042636 Ga0466703_246048 Ga0466703_246048_3405_4076 223
34 3300002462 JGI24702J35022_10018107 JGI24702J35022_100181073 224
35 3300042593 Ga0466691_051496 Ga0466691_051496_3606_4280 224
36 3300042624 Ga0466735_058344 Ga0466735_058344_530_1240 224
37 3300009826 Ga0123355_10055601 Ga0123355_100556015 225
38 3300042603 Ga0466714_004323 Ga0466714_004323_3134_3811 225
39 3300042643 Ga0466704_594161 Ga0466704_594161_8636_9313 225
40 3300042648 Ga0466709_292477 Ga0466709_292477_2433_3110 225
41 iso_pr_bacteria 2820547636 2820548331 225
42 3300042601 Ga0466707_088010 Ga0466707_088010_3602_4282 226
43 3300042609 Ga0466722_072401 Ga0466722_072401_3736_4416 226
44 3300042618 Ga0466723_235996 Ga0466723_235996_3062_3871 226
45 iso_pr_bacteria 2820110010 2820110219 226
46 3300002504 JGI24705J35276_12231989 JGI24705J35276_122319894 227
47 3300042604 Ga0466717_011444 Ga0466717_011444_1074_1757 227
48 3300042609 Ga0466722_010481 Ga0466722_010481_298_981 227
49 3300042619 Ga0466726_340762 Ga0466726_340762_1598_2281 227
50 3300042620 Ga0466728_481466 Ga0466728_481466_218_901 227
51 3300038395 Ga0415639_029080 Ga0415639_029080_1505_2191 228
52 3300038395 Ga0415639_119889 Ga0415639_119889_201_887 228
53 3300042603 Ga0466714_000287 Ga0466714_000287_59_778 228
54 3300042606 Ga0466719_368744 Ga0466719_368744_17194_17880 228
55 3300042616 Ga0466715_099998 Ga0466715_099998_8364_9050 228
56 3300042618 Ga0466723_271571 Ga0466723_271571_359_1045 228
57 iso_pr_bacteria 2940413413 2940418365 228
58 iso_pr_bacteria 2940419646 2940424190 228
59 iso_pr_bacteria 2940425923 2940430460 228
60 3300038395 Ga0415639_195224 Ga0415639_195224_714_1403 229
61 3300042596 Ga0466696_020333 Ga0466696_020333_14206_14895 229
62 3300042600 Ga0466700_440816 Ga0466700_440816_1132_1821 229
63 3300042612 Ga0466705_118471 Ga0466705_118471_716_1405 229
64 3300042612 Ga0466705_256487 Ga0466705_256487_121450_122139 229
65 3300042616 Ga0466715_285516 Ga0466715_285516_2984_3673 229
66 3300042618 Ga0466723_287335 Ga0466723_287335_1720_2409 229
67 iso_pr_bacteria 2820106212 2820108903 229
68 3300007505 Ga0105005_1025498 Ga0105005_10254986 230
69 3300010049 Ga0123356_10591041 Ga0123356_105910412 230
70 3300042590 Ga0466690_389304 Ga0466690_389304_316_1008 230
71 3300042598 Ga0466701_035767 Ga0466701_035767_3214_3906 230
72 3300042601 Ga0466707_027215 Ga0466707_027215_8730_9422 230
73 3300042605 Ga0466716_092166 Ga0466716_092166_554_1246 230
74 3300042605 Ga0466716_252663 Ga0466716_252663_2262_2954 230
75 3300042605 Ga0466716_349587 Ga0466716_349587_782_1474 230
76 3300042610 Ga0466698_385525 Ga0466698_385525_580_1272 230
77 3300042612 Ga0466705_458442 Ga0466705_458442_3965_4657 230
78 3300042612 Ga0466705_481115 Ga0466705_481115_20048_20740 230
79 3300042617 Ga0466718_064991 Ga0466718_064991_1269_1961 230
80 3300042618 Ga0466723_043308 Ga0466723_043308_2840_3532 230
81 3300042618 Ga0466723_052549 Ga0466723_052549_3178_3870 230
82 3300042652 Ga0466708_062858 Ga0466708_062858_6485_7177 230
83 3300005200 Ga0072940_1065882 Ga0072940_10658827 231
84 3300042616 Ga0466715_547104 Ga0466715_547104_22014_22709 231
85 3300042618 Ga0466723_098598 Ga0466723_098598_570_1265 231
86 iso_pr_bacteria 2758568796 2761046904 231
87 iso_pr_bacteria 2820111668 2820114557 231
88 iso_pr_bacteria 2820641689 2820642283 231
89 3300042617 Ga0466718_020883 Ga0466718_020883_268_966 232
90 3300002462 JGI24702J35022_10204535 JGI24702J35022_102045352 233
91 3300009826 Ga0123355_10000005 Ga0123355_10000005172 233
92 3300042590 Ga0466690_137464 Ga0466690_137464_1783_2484 233
93 iso_pr_bacteria 2873776654 2873781093 233
94 iso_pr_bacteria 2940380068 2940384455 233
95 iso_pr_bacteria 2940386776 2940391167 233
96 iso_pr_bacteria 2940393498 2940397740 233
97 iso_pr_bacteria 2940400224 2940404472 233
98 iso_pr_bacteria 2940406939 2940411075 233
99 3300002449 JGI24698J34947_10080195 JGI24698J34947_100801952 234
100 3300002450 JGI24695J34938_10049270 JGI24695J34938_100492704 234
101 3300010167 Ga0123353_10358355 Ga0123353_103583552 234
102 3300012854 Ga0160448_110718 Ga0160448_1107182 234
103 3300042616 Ga0466715_279396 Ga0466715_279396_547_1251 234
104 3300042618 Ga0466723_367555 Ga0466723_367555_5608_6312 234
105 3300042624 Ga0466735_118102 Ga0466735_118102_763_1467 234
106 3300042600 Ga0466700_238039 Ga0466700_238039_1250_1957 235
107 3300042613 Ga0466710_021228 Ga0466710_021228_9186_9893 235
108 3300000036 IMNBGM34_c000689 IMNBGM34_0006897 236
109 3300010167 Ga0123353_10392137 Ga0123353_103921373 236
110 3300042582 Ga0466657_016832 Ga0466657_016832_808_1518 236
111 3300042603 Ga0466714_168878 Ga0466714_168878_1209_1919 236
112 3300042612 Ga0466705_273242 Ga0466705_273242_165_875 236
113 3300042612 Ga0466705_383677 Ga0466705_383677_101_811 236
114 3300042615 Ga0466711_453482 Ga0466711_453482_436_1146 236
115 3300042643 Ga0466704_091891 Ga0466704_091891_10_720 236
116 3300010049 Ga0123356_10038738 Ga0123356_100387383 237
117 3300010049 Ga0123356_10293995 Ga0123356_102939952 238
118 3300042598 Ga0466701_079905 Ga0466701_079905_283_1002 239
119 iso_pr_bacteria 2820215626 2820216287 239
120 3300010049 Ga0123356_11013585 Ga0123356_110135851 240
121 3300009784 Ga0123357_10001422 Ga0123357_100014227 244
122 iso_pr_bacteria 2551306396 2552923891 244
123 iso_pr_bacteria 2983866074 2983867004 244
124 3300038395 Ga0415639_139949 Ga0415639_139949_105_842 245
125 3300042636 Ga0466703_393525 Ga0466703_393525_9804_10541 245
126 iso_pr_bacteria 2524614537 2524836784 247
127 iso_pr_bacteria 2827179085 2827180738 247
128 3300012847 Ga0160445_100580 Ga0160445_1005806 248
129 3300042618 Ga0466723_217856 Ga0466723_217856_7449_8195 248
130 3300012809 Ga0160466_100934 Ga0160466_1009348 250
131 3300042611 Ga0466697_092531 Ga0466697_092531_103_855 250
132 3300042656 Ga0466732_365083 Ga0466732_365083_2034_2786 250
133 3300042601 Ga0466707_129172 Ga0466707_129172_2423_3196 257
134 3300012814 Ga0160453_100350 Ga0160453_10035032 262

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01168 Ala_racemase_N Alanine racemase, N-terminal domain 58 244 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.