Protein Family IF03617
Metagenome
Isolate
244
Members
140
Samples
200
Scaffolds
300.74
Avg Length
Representative Sequence
- ID
- 3300012809|Ga0160466_102494|Ga0160466_1024944
- Length
- 336 aa
- Sequence
- MNIVLIFEVGYVEGTISTTSIYRSQPAIQIGNIGVIHLSLTHLDKLEAEAIYIFREVAAECERPVMLYSIGKDSSVMLHLAMKAFYPEKPPFPLLQIDTSWKFREMIEFRDRRAQELGVDLIVHRNEAAIAQGINPFDHGSAYTDIMKTQALKEALTKYQFTAAFGGGRRDEEKSRAKERIFSFRNEQHTWDPKNQRPEMWKLYNTRINKGESMRVFPISNWTEKDIWQYIQRENIEIVPLYFAAERPVVHRDGNIIMGDDSRMRLLPGETPEMKKVRFRTLGCYPLTGGIESEADTLDEVIAETLSATTSERTSRVIDKEAAGSMERRKREGYF*
Sample Types
Isolate
18.0%
Metagenome
82.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.0%
Formicidae
14.4%
Unclassified
10.4%
Kalotermitidae
9.6%
Elmidae
9.6%
Culicidae
7.2%
Curculionidae
5.6%
Armadillidiidae
4.8%
Termopsidae
2.4%
Rhinotermitidae
1.6%
Apidae
1.6%
Aphididae
1.6%
Siricidae
0.8%
Hydrophilidae
0.8%
Daphniidae
0.8%
Hodotermitidae
0.8%
Trigoniulidae
0.8%
Muscidae
0.8%
Gryllidae
0.8%
Drosophilidae
0.8%
Hormaphididae
0.8%
Taxonomy
Archaea
0
Bacteria
216
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 2 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 3 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 4 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 5 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 6 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 7 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 8 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 15 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 16 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 17 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 18 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 19 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 20 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 21 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 22 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 23 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 24 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 27 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 28 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 29 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 30 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 31 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 32 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 33 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 34 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 38 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 39 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 40 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 41 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 42 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 43 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 44 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 55 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 56 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 57 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 58 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 59 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 60 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 61 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 62 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 63 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 64 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 65 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 66 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 67 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 68 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 69 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 70 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 71 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 72 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 73 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 74 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 75 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 76 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 77 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 78 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 79 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 80 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 83 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 84 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 85 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 86 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 87 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 88 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 89 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 90 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 91 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 92 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 93 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 94 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 95 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 96 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 97 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 98 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 99 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 100 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 101 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 102 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 103 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 104 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 105 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 106 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 107 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 108 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 109 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 110 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 111 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 112 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 113 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 114 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 115 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 116 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 117 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 118 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 119 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 120 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 121 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 122 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 123 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 124 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 125 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 126 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 127 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 128 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 129 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 130 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 131 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 132 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 133 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 134 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 135 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 136 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 137 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 138 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 139 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 140 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_268778 | 3300042656 | Bacteria | 10049 |
| 2 | SWWA_contig31654__length_27095___numreads_1604 | 2100351016 | Unclassified | 27095 |
| 3 | JGI24695J34938_10000498 | 3300002450 | Bacteria | 38104 |
| 4 | Meta3P_1002829 | 3300002464 | Bacteria | 2612 |
| 5 | Ga0072941_1009272 | 3300005201 | Bacteria | 9522 |
| 6 | Ga0103267_1000007 | 3300007190 | Bacteria | 77495 |
| 7 | Ga0123355_10306981 | 3300009826 | Bacteria | 2156 |
| 8 | Ga0123355_10395488 | 3300009826 | Bacteria | 1787 |
| 9 | Ga0123353_10453867 | 3300010167 | Bacteria | 1886 |
| 10 | Ga0123354_10144430 | 3300010882 | Bacteria | 2922 |
| 11 | Ga0466710_401879 | 3300042613 | Bacteria | 1596 |
| 12 | Ga0466715_324564 | 3300042616 | Bacteria | 17911 |
| 13 | Ga0466726_168064 | 3300042619 | Unclassified | 1140 |
| 14 | Ga0466726_175080 | 3300042619 | Bacteria | 14110 |
| 15 | Ga0466706_210174 | 3300042599 | Bacteria | 4941 |
| 16 | Ga0466707_068045 | 3300042601 | Bacteria | 1503 |
| 17 | Ga0466707_355732 | 3300042601 | Bacteria | 3759 |
| 18 | Ga0466716_515942 | 3300042605 | Unclassified | 3512 |
| 19 | Ga0160467_101473 | 3300012829 | Unclassified | 8931 |
| 20 | Ga0160434_100089 | 3300012850 | Bacteria | 56576 |
| 21 | Ga0160435_1000052 | 3300012857 | Bacteria | 84353 |
| 22 | Ga0466690_238281 | 3300042590 | Bacteria | 2866 |
| 23 | Ga0466729_292118 | 3300042621 | Bacteria | 37917 |
| 24 | Ga0466708_057703 | 3300042652 | Bacteria | 15693 |
| 25 | Ga0466708_436718 | 3300042652 | Bacteria | 1485 |
| 26 | Ga0466733_134568 | 3300042659 | Bacteria | 5858 |
| 27 | JGI24699J35502_11048448 | 3300002509 | Bacteria | 1631 |
| 28 | CVPL005W_1000039 | 3300002934 | Bacteria | 48142 |
| 29 | Ga0123355_10006280 | 3300009826 | Bacteria | 17567 |
| 30 | Ga0123355_10727035 | 3300009826 | Bacteria | 1130 |
| 31 | Ga0123356_10013472 | 3300010049 | Bacteria | 7891 |
| 32 | Ga0123356_10067792 | 3300010049 | Bacteria | 3342 |
| 33 | Ga0466712_052394 | 3300042614 | Unclassified | 16802 |
| 34 | Ga0466701_050835 | 3300042598 | Bacteria | 85783 |
| 35 | Ga0466706_098712 | 3300042599 | Bacteria | 1814 |
| 36 | Ga0466713_020958 | 3300042602 | Bacteria | 10951 |
| 37 | Ga0466722_094696 | 3300042609 | Bacteria | 68121 |
| 38 | Ga0160430_100003 | 3300012852 | Bacteria | 419621 |
| 39 | Ga0415639_022410 | 3300038395 | Bacteria | 14807 |
| 40 | Ga0466690_170116 | 3300042590 | Bacteria | 15006 |
| 41 | Ga0466696_007600 | 3300042596 | Bacteria | 1844 |
| 42 | Ga0466703_040747 | 3300042636 | Bacteria | 40585 |
| 43 | Ga0072941_1000307 | 3300005201 | Bacteria | 10163 |
| 44 | Ga0072941_1010351 | 3300005201 | Bacteria | 25447 |
| 45 | Ga0103265_1002871 | 3300007068 | Unclassified | 2617 |
| 46 | Ga0103261_1000146 | 3300007083 | Bacteria | 12229 |
| 47 | Ga0104019_1190069 | 3300007150 | Bacteria | 2890 |
| 48 | Ga0103264_1000415 | 3300007188 | Bacteria | 26296 |
| 49 | Ga0127530_101127 | 3300009468 | Bacteria | 89438 |
| 50 | Ga0123357_10107397 | 3300009784 | Bacteria | 3574 |
| 51 | Ga0123357_10315732 | 3300009784 | Bacteria | 1552 |
| 52 | Ga0123356_10130292 | 3300010049 | Bacteria | 2463 |
| 53 | Ga0123356_10469921 | 3300010049 | Bacteria | 1409 |
| 54 | Ga0123353_10000049 | 3300010167 | Bacteria | 131325 |
| 55 | Ga0160444_100108 | 3300012841 | Bacteria | 96718 |
| 56 | Ga0160447_100076 | 3300012849 | Bacteria | 88547 |
| 57 | Ga0466694_049318 | 3300042594 | Bacteria | 5076 |
| 58 | Ga0466730_058156 | 3300042625 | Unclassified | 1219 |
| 59 | Ga0466702_231536 | 3300042635 | Bacteria | 1438 |
| 60 | Ga0466703_350440 | 3300042636 | Bacteria | 2717 |
| 61 | Ga0466703_426323 | 3300042636 | Bacteria | 14021 |
| 62 | Ga0466708_291469 | 3300042652 | Bacteria | 8603 |
| 63 | Ga0466727_173561 | 3300042655 | Bacteria | 3755 |
| 64 | JGI24703J35330_11748245 | 3300002501 | Bacteria | 12498 |
| 65 | Ga0072940_1088289 | 3300005200 | Bacteria | 2835 |
| 66 | Ga0072940_1217065 | 3300005200 | Bacteria | 5319 |
| 67 | Ga0103263_101370 | 3300007042 | Unclassified | 3169 |
| 68 | Ga0103263_102636 | 3300007042 | Bacteria | 2203 |
| 69 | Ga0102740_1000335 | 3300007140 | Unclassified | 13314 |
| 70 | Ga0102737_1004673 | 3300007142 | Unclassified | 2869 |
| 71 | Ga0102737_1007764 | 3300007142 | Unclassified | 1933 |
| 72 | Ga0103268_1001129 | 3300007192 | Unclassified | 7506 |
| 73 | Ga0105524_105956 | 3300007733 | Bacteria | 1723 |
| 74 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 75 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 76 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 77 | Ga0160464_100196 | 3300012805 | Bacteria | 61467 |
| 78 | Ga0466712_300388 | 3300042614 | Bacteria | 31259 |
| 79 | Ga0466723_249905 | 3300042618 | Bacteria | 1415 |
| 80 | Ga0466726_354911 | 3300042619 | Bacteria | 6589 |
| 81 | Ga0466713_012829 | 3300042602 | Bacteria | 50075 |
| 82 | Ga0466713_055484 | 3300042602 | Bacteria | 81535 |
| 83 | Ga0466720_106930 | 3300042607 | Bacteria | 7582 |
| 84 | Ga0160443_100030 | 3300012848 | Bacteria | 361144 |
| 85 | Ga0160434_100012 | 3300012850 | Bacteria | 257031 |
| 86 | Ga0160436_1000681 | 3300012861 | Unclassified | 11576 |
| 87 | Ga0415639_069981 | 3300038395 | Unclassified | 2208 |
| 88 | Ga0415639_116670 | 3300038395 | Bacteria | 4254 |
| 89 | Ga0466735_190428 | 3300042624 | Bacteria | 1614 |
| 90 | Ga0466702_251883 | 3300042635 | Bacteria | 6589 |
| 91 | Ga0466727_127392 | 3300042655 | Bacteria | 21291 |
| 92 | SPBB_contig00046 | 2044078006 | Bacteria | 51175 |
| 93 | AustNasuHG_c1000173 | 3300000089 | Bacteria | 20878 |
| 94 | CVPL010W_10000240 | 3300002931 | Unclassified | 51365 |
| 95 | CVPL005W_1000135 | 3300002934 | Bacteria | 31407 |
| 96 | Ga0072941_1014361 | 3300005201 | Unclassified | 8760 |
| 97 | Ga0072941_1014679 | 3300005201 | Unclassified | 26393 |
| 98 | Ga0103261_1000013 | 3300007083 | Unclassified | 87429 |
| 99 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 100 | Ga0123353_10333160 | 3300010167 | Bacteria | 2296 |
| 101 | Ga0466712_161324 | 3300042614 | Bacteria | 10736 |
| 102 | Ga0466712_195725 | 3300042614 | Bacteria | 5696 |
| 103 | Ga0466711_316000 | 3300042615 | Bacteria | 1337 |
| 104 | Ga0466715_070790 | 3300042616 | Bacteria | 9926 |
| 105 | Ga0466726_022307 | 3300042619 | Bacteria | 12981 |
| 106 | Ga0466726_135545 | 3300042619 | Bacteria | 3698 |
| 107 | Ga0466726_423823 | 3300042619 | Bacteria | 22082 |
| 108 | Ga0466728_258406 | 3300042620 | Bacteria | 7709 |
| 109 | Ga0466728_301543 | 3300042620 | Bacteria | 7395 |
| 110 | Ga0466707_288430 | 3300042601 | Bacteria | 123170 |
| 111 | Ga0466721_330899 | 3300042608 | Bacteria | 5713 |
| 112 | Ga0160470_106818 | 3300012813 | Bacteria | 1284 |
| 113 | Ga0160467_100354 | 3300012829 | Bacteria | 48296 |
| 114 | Ga0160444_108060 | 3300012841 | Bacteria | 1332 |
| 115 | Ga0160460_100022 | 3300012845 | Bacteria | 343535 |
| 116 | Ga0160434_100194 | 3300012850 | Unclassified | 29318 |
| 117 | Ga0160448_100472 | 3300012854 | Bacteria | 13914 |
| 118 | Ga0264413_102558 | 3300024493 | Bacteria | 23699 |
| 119 | Ga0309904_1000034 | 3300029810 | Bacteria | 11200 |
| 120 | Ga0466729_304891 | 3300042621 | Bacteria | 5104 |
| 121 | Ga0466727_348452 | 3300042655 | Bacteria | 1362 |
| 122 | HBC_ctgsDRAFT_1000305 | 3300000333 | Bacteria | 11186 |
| 123 | JGI24698J34947_10008757 | 3300002449 | Unclassified | 5549 |
| 124 | JGI24698J34947_10066823 | 3300002449 | Bacteria | 1748 |
| 125 | JGI24697J35500_11253361 | 3300002507 | Bacteria | 2620 |
| 126 | Ga0072941_1014622 | 3300005201 | Bacteria | 3385 |
| 127 | Ga0103266_1000055 | 3300007067 | Bacteria | 76804 |
| 128 | Ga0103265_1006488 | 3300007068 | Unclassified | 2371 |
| 129 | Ga0102734_1019084 | 3300007129 | Bacteria | 1693 |
| 130 | Ga0103264_1033925 | 3300007188 | Bacteria | 3239 |
| 131 | Ga0103268_1000251 | 3300007192 | Unclassified | 17659 |
| 132 | Ga0103268_1005249 | 3300007192 | Bacteria | 2625 |
| 133 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 134 | Ga0123355_10314737 | 3300009826 | Bacteria | 2117 |
| 135 | Ga0123356_10054254 | 3300010049 | Bacteria | 3733 |
| 136 | Ga0123356_10091639 | 3300010049 | Bacteria | 2897 |
| 137 | Ga0123353_10382502 | 3300010167 | Bacteria | 2104 |
| 138 | Ga0123354_10111440 | 3300010882 | Bacteria | 3610 |
| 139 | Ga0123354_10144905 | 3300010882 | Bacteria | 2914 |
| 140 | Ga0160466_102494 | 3300012809 | Bacteria | 3593 |
| 141 | Ga0466705_508585 | 3300042612 | Bacteria | 20766 |
| 142 | Ga0466712_010827 | 3300042614 | Bacteria | 8025 |
| 143 | Ga0466715_098088 | 3300042616 | Bacteria | 24598 |
| 144 | Ga0466718_041095 | 3300042617 | Bacteria | 43589 |
| 145 | Ga0466726_026910 | 3300042619 | Bacteria | 15196 |
| 146 | Ga0160469_100012 | 3300012824 | Bacteria | 446228 |
| 147 | Ga0160445_114552 | 3300012847 | Unclassified | 1101 |
| 148 | Ga0264413_103743 | 3300024493 | Bacteria | 33640 |
| 149 | Ga0415639_059600 | 3300038395 | Bacteria | 6612 |
| 150 | Ga0466699_280126 | 3300042597 | Bacteria | 2305 |
| 151 | Ga0466704_598397 | 3300042643 | Bacteria | 5390 |
| 152 | Ga0466709_036839 | 3300042648 | Bacteria | 1022 |
| 153 | Ga0466709_266210 | 3300042648 | Bacteria | 21862 |
| 154 | Ga0466708_282706 | 3300042652 | Bacteria | 23372 |
| 155 | Ga0466708_287852 | 3300042652 | Bacteria | 24112 |
| 156 | Ga0466697_259245 | 3300042611 | Bacteria | 4384 |
| 157 | Ga0466705_021724 | 3300042612 | Bacteria | 82521 |
| 158 | Ga0466705_146391 | 3300042612 | Bacteria | 54051 |
| 159 | Ga0466733_182659 | 3300042659 | Bacteria | 183103 |
| 160 | Ga0072941_1039164 | 3300005201 | Unclassified | 5483 |
| 161 | Ga0072941_1387877 | 3300005201 | Bacteria | 7239 |
| 162 | Ga0102736_1000177 | 3300007052 | Bacteria | 14987 |
| 163 | Ga0103261_1005741 | 3300007083 | Bacteria | 1819 |
| 164 | Ga0103260_1000019 | 3300007139 | Bacteria | 70903 |
| 165 | Ga0102738_1004270 | 3300007141 | Bacteria | 2052 |
| 166 | Ga0123355_10163694 | 3300009826 | Bacteria | 3344 |
| 167 | Ga0123356_10265282 | 3300010049 | Bacteria | 1804 |
| 168 | Ga0123354_10298839 | 3300010882 | Bacteria | 1527 |
| 169 | Ga0466726_170647 | 3300042619 | Bacteria | 28203 |
| 170 | Ga0466726_228701 | 3300042619 | Bacteria | 4732 |
| 171 | Ga0466707_051388 | 3300042601 | Bacteria | 2744 |
| 172 | Ga0466707_247616 | 3300042601 | Bacteria | 82315 |
| 173 | Ga0466713_017640 | 3300042602 | Bacteria | 8491 |
| 174 | Ga0466713_132057 | 3300042602 | Bacteria | 3271 |
| 175 | Ga0466720_188165 | 3300042607 | Bacteria | 8298 |
| 176 | Ga0160468_100146 | 3300012819 | Bacteria | 63267 |
| 177 | Ga0160447_100624 | 3300012849 | Bacteria | 15818 |
| 178 | Ga0160448_100038 | 3300012854 | Bacteria | 124546 |
| 179 | Ga0160435_1001117 | 3300012857 | Bacteria | 6982 |
| 180 | Ga0309903_100011 | 3300029809 | Bacteria | 51837 |
| 181 | Ga0466734_139690 | 3300042623 | Bacteria | 1071 |
| 182 | Ga0466730_038334 | 3300042625 | Bacteria | 1125 |
| 183 | Ga0466709_145284 | 3300042648 | Bacteria | 67560 |
| 184 | SPBB_contig11522 | 2044078006 | Bacteria | 78101 |
| 185 | FGTW_contig30548 | 2065487013 | Bacteria | 17227 |
| 186 | JGI24698J34947_10025941 | 3300002449 | Bacteria | 3116 |
| 187 | Ga0072941_1000282 | 3300005201 | Bacteria | 7568 |
| 188 | Ga0102739_1000068 | 3300007095 | Bacteria | 29430 |
| 189 | Ga0123356_10025736 | 3300010049 | Unclassified | 5531 |
| 190 | Ga0123353_10507477 | 3300010167 | Bacteria | 1755 |
| 191 | Ga0136160_1000047 | 3300010225 | Bacteria | 637579 |
| 192 | Ga0466712_036145 | 3300042614 | Bacteria | 2141 |
| 193 | Ga0466712_036162 | 3300042614 | Unclassified | 4840 |
| 194 | Ga0466715_368297 | 3300042616 | Bacteria | 15219 |
| 195 | Ga0466728_467548 | 3300042620 | Bacteria | 9115 |
| 196 | Ga0466707_337756 | 3300042601 | Bacteria | 27033 |
| 197 | Ga0160448_106070 | 3300012854 | Unclassified | 3068 |
| 198 | Ga0160436_1011042 | 3300012861 | Unclassified | 1944 |
| 199 | Ga0466735_106770 | 3300042624 | Bacteria | 1450 |
| 200 | Ga0466708_387510 | 3300042652 | Bacteria | 13292 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007150 | Ga0104019_1190069 | Ga0104019_11900692 | 255 |
| 2 | 3300010049 | Ga0123356_10091639 | Ga0123356_100916392 | 272 |
| 3 | 3300042602 | Ga0466713_055484 | Ga0466713_055484_74278_75174 | 278 |
| 4 | 3300042621 | Ga0466729_292118 | Ga0466729_292118_11701_12597 | 278 |
| 5 | 3300042655 | Ga0466727_348452 | Ga0466727_348452_138_1028 | 278 |
| 6 | 3300042656 | Ga0466732_268778 | Ga0466732_268778_6184_7092 | 280 |
| 7 | 3300042596 | Ga0466696_007600 | Ga0466696_007600_115_963 | 282 |
| 8 | 3300042605 | Ga0466716_515942 | Ga0466716_515942_1851_2699 | 282 |
| 9 | 3300042612 | Ga0466705_508585 | Ga0466705_508585_13628_14518 | 282 |
| 10 | 3300042616 | Ga0466715_098088 | Ga0466715_098088_5035_5931 | 282 |
| 11 | 3300042619 | Ga0466726_175080 | Ga0466726_175080_8091_8981 | 282 |
| 12 | 3300042620 | Ga0466728_258406 | Ga0466728_258406_4932_5780 | 282 |
| 13 | 3300009826 | Ga0123355_10306981 | Ga0123355_103069812 | 283 |
| 14 | 3300010882 | Ga0123354_10144430 | Ga0123354_101444302 | 283 |
| 15 | 3300042601 | Ga0466707_247616 | Ga0466707_247616_51425_52306 | 283 |
| 16 | 3300042652 | Ga0466708_387510 | Ga0466708_387510_10822_11673 | 283 |
| 17 | 3300005201 | Ga0072941_1014679 | Ga0072941_101467921 | 284 |
| 18 | 3300009473 | Ga0127520_1000008 | Ga0127520_100000879 | 284 |
| 19 | 3300010882 | Ga0123354_10111440 | Ga0123354_101114402 | 284 |
| 20 | 3300042601 | Ga0466707_337756 | Ga0466707_337756_18787_19683 | 284 |
| 21 | 3300042619 | Ga0466726_135545 | Ga0466726_135545_1227_2123 | 284 |
| 22 | 3300042648 | Ga0466709_266210 | Ga0466709_266210_6042_6935 | 284 |
| 23 | 3300000089 | AustNasuHG_c1000173 | AustNasuHG_10001731 | 287 |
| 24 | 3300005201 | Ga0072941_1010351 | Ga0072941_101035111 | 287 |
| 25 | 3300042616 | Ga0466715_070790 | Ga0466715_070790_2129_3025 | 288 |
| 26 | 3300009826 | Ga0123355_10006280 | Ga0123355_100062805 | 289 |
| 27 | 3300042601 | Ga0466707_051388 | Ga0466707_051388_947_1846 | 290 |
| 28 | 3300042619 | Ga0466726_168064 | Ga0466726_168064_31_903 | 290 |
| 29 | 3300005200 | Ga0072940_1088289 | Ga0072940_10882892 | 291 |
| 30 | 3300005201 | Ga0072941_1000282 | Ga0072941_10002825 | 291 |
| 31 | 3300005201 | Ga0072941_1039164 | Ga0072941_10391642 | 291 |
| 32 | 3300038395 | Ga0415639_069981 | Ga0415639_069981_615_1490 | 291 |
| 33 | 3300042619 | Ga0466726_026910 | Ga0466726_026910_11650_12525 | 291 |
| 34 | 3300010167 | Ga0123353_10453867 | Ga0123353_104538672 | 292 |
| 35 | 3300042643 | Ga0466704_598397 | Ga0466704_598397_3084_3962 | 292 |
| 36 | 3300005201 | Ga0072941_1000307 | Ga0072941_10003071 | 293 |
| 37 | 3300042652 | Ga0466708_057703 | Ga0466708_057703_11442_12323 | 293 |
| 38 | 3300042590 | Ga0466690_238281 | Ga0466690_238281_1478_2362 | 294 |
| 39 | 3300042648 | Ga0466709_036839 | Ga0466709_036839_84_968 | 294 |
| 40 | 3300010049 | Ga0123356_10469921 | Ga0123356_104699212 | 295 |
| 41 | 3300042599 | Ga0466706_210174 | Ga0466706_210174_433_1323 | 296 |
| 42 | 3300042602 | Ga0466713_017640 | Ga0466713_017640_6650_7540 | 296 |
| 43 | 3300042615 | Ga0466711_316000 | Ga0466711_316000_260_1150 | 296 |
| 44 | 3300042616 | Ga0466715_324564 | Ga0466715_324564_13177_14067 | 296 |
| 45 | 3300042616 | Ga0466715_368297 | Ga0466715_368297_6207_7097 | 296 |
| 46 | 3300042619 | Ga0466726_423823 | Ga0466726_423823_6375_7265 | 296 |
| 47 | 3300042624 | Ga0466735_190428 | Ga0466735_190428_33_923 | 296 |
| 48 | 3300042636 | Ga0466703_040747 | Ga0466703_040747_29214_30104 | 296 |
| 49 | 3300042652 | Ga0466708_436718 | Ga0466708_436718_529_1419 | 296 |
| 50 | iso_pr_bacteria | 2820831444 | 2820832728 | 296 |
| 51 | 3300005200 | Ga0072940_1217065 | Ga0072940_12170654 | 297 |
| 52 | 3300010882 | Ga0123354_10298839 | Ga0123354_102988392 | 297 |
| 53 | 3300042602 | Ga0466713_020958 | Ga0466713_020958_8251_9144 | 297 |
| 54 | 3300042624 | Ga0466735_106770 | Ga0466735_106770_325_1218 | 297 |
| 55 | 3300042652 | Ga0466708_282706 | Ga0466708_282706_6446_7369 | 297 |
| 56 | 3300042655 | Ga0466727_173561 | Ga0466727_173561_900_1793 | 297 |
| 57 | 3300010049 | Ga0123356_10265282 | Ga0123356_102652822 | 298 |
| 58 | 3300012861 | Ga0160436_1000681 | Ga0160436_10006817 | 298 |
| 59 | 3300012861 | Ga0160436_1011042 | Ga0160436_10110422 | 298 |
| 60 | 3300024493 | Ga0264413_102558 | Ga0264413_10255814 | 298 |
| 61 | 3300042590 | Ga0466690_170116 | Ga0466690_170116_3379_4275 | 298 |
| 62 | 3300042598 | Ga0466701_050835 | Ga0466701_050835_24036_24932 | 298 |
| 63 | 3300042601 | Ga0466707_068045 | Ga0466707_068045_582_1478 | 298 |
| 64 | 3300042601 | Ga0466707_288430 | Ga0466707_288430_7759_8655 | 298 |
| 65 | 3300042601 | Ga0466707_355732 | Ga0466707_355732_2537_3433 | 298 |
| 66 | 3300042609 | Ga0466722_094696 | Ga0466722_094696_53084_53980 | 298 |
| 67 | 3300042614 | Ga0466712_036145 | Ga0466712_036145_47_943 | 298 |
| 68 | 3300042614 | Ga0466712_036162 | Ga0466712_036162_2310_3206 | 298 |
| 69 | 3300042614 | Ga0466712_052394 | Ga0466712_052394_12984_13880 | 298 |
| 70 | 3300042614 | Ga0466712_161324 | Ga0466712_161324_768_1664 | 298 |
| 71 | 3300042614 | Ga0466712_300388 | Ga0466712_300388_25678_26574 | 298 |
| 72 | 3300042617 | Ga0466718_041095 | Ga0466718_041095_20964_21860 | 298 |
| 73 | 3300042619 | Ga0466726_354911 | Ga0466726_354911_1097_1993 | 298 |
| 74 | 3300042620 | Ga0466728_467548 | Ga0466728_467548_6254_7150 | 298 |
| 75 | 3300042625 | Ga0466730_058156 | Ga0466730_058156_271_1167 | 298 |
| 76 | 3300042636 | Ga0466703_350440 | Ga0466703_350440_1005_1901 | 298 |
| 77 | 3300042648 | Ga0466709_145284 | Ga0466709_145284_31504_32400 | 298 |
| 78 | 3300002449 | JGI24698J34947_10008757 | JGI24698J34947_100087572 | 299 |
| 79 | 3300002449 | JGI24698J34947_10025941 | JGI24698J34947_100259413 | 299 |
| 80 | 3300002507 | JGI24697J35500_11253361 | JGI24697J35500_112533612 | 299 |
| 81 | 3300002509 | JGI24699J35502_11048448 | JGI24699J35502_110484482 | 299 |
| 82 | 3300005201 | Ga0072941_1009272 | Ga0072941_10092726 | 299 |
| 83 | 3300005201 | Ga0072941_1014361 | Ga0072941_10143617 | 299 |
| 84 | 3300010167 | Ga0123353_10507477 | Ga0123353_105074772 | 299 |
| 85 | 3300012829 | Ga0160467_100354 | Ga0160467_10035459 | 299 |
| 86 | 3300024493 | Ga0264413_103743 | Ga0264413_10374318 | 299 |
| 87 | 3300038395 | Ga0415639_059600 | Ga0415639_059600_3205_4104 | 299 |
| 88 | 3300042599 | Ga0466706_098712 | Ga0466706_098712_607_1506 | 299 |
| 89 | 3300042611 | Ga0466697_259245 | Ga0466697_259245_2489_3388 | 299 |
| 90 | 3300042612 | Ga0466705_146391 | Ga0466705_146391_6087_6986 | 299 |
| 91 | 3300042619 | Ga0466726_170647 | Ga0466726_170647_16667_17566 | 299 |
| 92 | 3300042635 | Ga0466702_251883 | Ga0466702_251883_5442_6341 | 299 |
| 93 | 3300042636 | Ga0466703_426323 | Ga0466703_426323_2263_3162 | 299 |
| 94 | 3300042652 | Ga0466708_291469 | Ga0466708_291469_3949_4872 | 299 |
| 95 | 3300042659 | Ga0466733_134568 | Ga0466733_134568_3871_4770 | 299 |
| 96 | iso_pr_bacteria | 2590828840 | 2593256395 | 299 |
| 97 | iso_pr_bacteria | 2590828840 | 2593257760 | 299 |
| 98 | iso_pr_bacteria | 2593339125 | 2595066995 | 299 |
| 99 | 3300002501 | JGI24703J35330_11748245 | JGI24703J35330_117482456 | 300 |
| 100 | 3300010167 | Ga0123353_10000049 | Ga0123353_1000004974 | 300 |
| 101 | 3300010167 | Ga0123353_10333160 | Ga0123353_103331602 | 300 |
| 102 | 3300029809 | Ga0309903_100011 | Ga0309903_10001111 | 300 |
| 103 | 3300029810 | Ga0309904_1000034 | Ga0309904_10000343 | 300 |
| 104 | 3300042597 | Ga0466699_280126 | Ga0466699_280126_1331_2233 | 300 |
| 105 | 3300042623 | Ga0466734_139690 | Ga0466734_139690_103_1005 | 300 |
| 106 | iso_pr_bacteria | 2556921669 | 2558279971 | 300 |
| 107 | 3300007042 | Ga0103263_102636 | Ga0103263_1026362 | 301 |
| 108 | 3300009784 | Ga0123357_10315732 | Ga0123357_103157322 | 301 |
| 109 | 3300042602 | Ga0466713_132057 | Ga0466713_132057_2026_2931 | 301 |
| 110 | 3300042607 | Ga0466720_106930 | Ga0466720_106930_243_1148 | 301 |
| 111 | 3300042621 | Ga0466729_304891 | Ga0466729_304891_1141_2046 | 301 |
| 112 | 3300042635 | Ga0466702_231536 | Ga0466702_231536_417_1322 | 301 |
| 113 | 3300042659 | Ga0466733_182659 | Ga0466733_182659_128493_129398 | 301 |
| 114 | iso_pr_bacteria | 2820093073 | 2820093218 | 301 |
| 115 | iso_pr_bacteria | 2820671341 | 2820671345 | 301 |
| 116 | 3300002450 | JGI24695J34938_10000498 | JGI24695J34938_100004985 | 302 |
| 117 | 3300007733 | Ga0105524_105956 | Ga0105524_1059562 | 302 |
| 118 | 3300009826 | Ga0123355_10314737 | Ga0123355_103147371 | 302 |
| 119 | 3300010049 | Ga0123356_10013472 | Ga0123356_100134722 | 302 |
| 120 | 3300010049 | Ga0123356_10054254 | Ga0123356_100542542 | 302 |
| 121 | 3300010049 | Ga0123356_10067792 | Ga0123356_100677922 | 302 |
| 122 | 3300042614 | Ga0466712_010827 | Ga0466712_010827_2607_3515 | 302 |
| 123 | 3300042652 | Ga0466708_287852 | Ga0466708_287852_19569_20492 | 302 |
| 124 | iso_pr_bacteria | 2585427605 | 2585886778 | 302 |
| 125 | iso_pr_bacteria | 2585428048 | 2587691479 | 302 |
| 126 | 3300009456 | Ga0127523_100016 | Ga0127523_100016438 | 303 |
| 127 | 3300009458 | Ga0127646_100058 | Ga0127646_100058390 | 303 |
| 128 | 3300009468 | Ga0127530_101127 | Ga0127530_10112738 | 303 |
| 129 | 3300009477 | Ga0127522_100011 | Ga0127522_10001121 | 303 |
| 130 | 3300009493 | Ga0127654_100011 | Ga0127654_100011219 | 303 |
| 131 | 3300010167 | Ga0123353_10382502 | Ga0123353_103825022 | 303 |
| 132 | 3300012813 | Ga0160470_106818 | Ga0160470_1068181 | 303 |
| 133 | 3300012847 | Ga0160445_114552 | Ga0160445_1145521 | 303 |
| 134 | 3300012850 | Ga0160434_100194 | Ga0160434_10019412 | 303 |
| 135 | iso_pr_bacteria | 2528768159 | 2529055596 | 303 |
| 136 | iso_pr_bacteria | 2873562573 | 2873563997 | 303 |
| 137 | 3300005201 | Ga0072941_1387877 | Ga0072941_13878772 | 304 |
| 138 | 3300007052 | Ga0102736_1000177 | Ga0102736_100017716 | 304 |
| 139 | 3300007192 | Ga0103268_1005249 | Ga0103268_10052492 | 304 |
| 140 | 3300012824 | Ga0160469_100012 | Ga0160469_100012339 | 304 |
| 141 | 3300012841 | Ga0160444_100108 | Ga0160444_10010833 | 304 |
| 142 | 3300012850 | Ga0160434_100012 | Ga0160434_10001227 | 304 |
| 143 | 3300012852 | Ga0160430_100003 | Ga0160430_10000367 | 304 |
| 144 | 3300012854 | Ga0160448_100038 | Ga0160448_10003811 | 304 |
| 145 | 3300042607 | Ga0466720_188165 | Ga0466720_188165_4786_5745 | 304 |
| 146 | 3300042625 | Ga0466730_038334 | Ga0466730_038334_180_1094 | 304 |
| 147 | iso_pr_bacteria | 2989793055 | 2989796538 | 304 |
| 148 | 2044078006 | SPBB_contig00046 | SPBB_489250 | 305 |
| 149 | 2044078006 | SPBB_contig11522 | SPBB_327970 | 305 |
| 150 | 2065487013 | FGTW_contig30548 | FGTW_01432790 | 305 |
| 151 | 2100351016 | SWWA_contig31654__length_27095___numreads_1604 | SWWA_01956920 | 305 |
| 152 | 3300002931 | CVPL010W_10000240 | CVPL010W_1000024039 | 305 |
| 153 | 3300002934 | CVPL005W_1000039 | CVPL005W_100003933 | 305 |
| 154 | 3300007042 | Ga0103263_101370 | Ga0103263_1013702 | 305 |
| 155 | 3300007083 | Ga0103261_1000013 | Ga0103261_100001331 | 305 |
| 156 | 3300007095 | Ga0102739_1000068 | Ga0102739_100006818 | 305 |
| 157 | 3300007139 | Ga0103260_1000019 | Ga0103260_100001965 | 305 |
| 158 | 3300007140 | Ga0102740_1000335 | Ga0102740_10003359 | 305 |
| 159 | 3300007141 | Ga0102738_1004270 | Ga0102738_10042702 | 305 |
| 160 | 3300007142 | Ga0102737_1007764 | Ga0102737_10077642 | 305 |
| 161 | 3300007192 | Ga0103268_1000251 | Ga0103268_10002512 | 305 |
| 162 | 3300012841 | Ga0160444_108060 | Ga0160444_1080601 | 305 |
| 163 | iso_pr_bacteria | 2519899622 | 2520387553 | 305 |
| 164 | iso_pr_bacteria | 2603880173 | 2606036678 | 305 |
| 165 | iso_pr_bacteria | 2687453754 | 2690040526 | 305 |
| 166 | iso_pr_bacteria | 2687453755 | 2690044011 | 305 |
| 167 | iso_pr_bacteria | 2687453756 | 2690046069 | 305 |
| 168 | iso_pr_bacteria | 2864739902 | 2864741741 | 305 |
| 169 | iso_pr_bacteria | 2864745180 | 2864749866 | 305 |
| 170 | iso_pr_bacteria | 2864751016 | 2864754887 | 305 |
| 171 | iso_pr_bacteria | 2864847319 | 2864849490 | 305 |
| 172 | iso_pr_bacteria | 2864853652 | 2864858068 | 305 |
| 173 | iso_pr_bacteria | 2864903489 | 2864906663 | 305 |
| 174 | iso_pr_bacteria | 2864944480 | 2864944619 | 305 |
| 175 | iso_pr_bacteria | 2870361953 | 2870364301 | 305 |
| 176 | iso_pr_bacteria | 2987233858 | 2987236549 | 305 |
| 177 | iso_pr_bacteria | 2990166910 | 2990169693 | 305 |
| 178 | iso_pr_bacteria | 3000478755 | 3000479055 | 305 |
| 179 | iso_pr_bacteria | 3007473699 | 3007478106 | 305 |
| 180 | iso_pr_bacteria | 3007478678 | 3007481191 | 305 |
| 181 | iso_pr_bacteria | 637000219 | 638003412 | 305 |
| 182 | iso_pr_bacteria | 8011329375 | 8011334589 | 305 |
| 183 | iso_pr_bacteria | 8011357093 | 8011359135 | 305 |
| 184 | iso_pr_bacteria | 8035321120 | 8035326443 | 305 |
| 185 | iso_pr_bacteria | 8035326735 | 8035331632 | 305 |
| 186 | iso_pr_bacteria | 8035422605 | 8035424500 | 305 |
| 187 | iso_pr_bacteria | 8052469819 | 8052474873 | 305 |
| 188 | 3300000333 | HBC_ctgsDRAFT_1000305 | HBC_ctgsDRAFT_10003055 | 306 |
| 189 | 3300002464 | Meta3P_1002829 | Meta3P_10028292 | 306 |
| 190 | 3300002934 | CVPL005W_1000135 | CVPL005W_100013516 | 306 |
| 191 | 3300007067 | Ga0103266_1000055 | Ga0103266_10000552 | 306 |
| 192 | 3300007068 | Ga0103265_1002871 | Ga0103265_10028712 | 306 |
| 193 | 3300007068 | Ga0103265_1006488 | Ga0103265_10064882 | 306 |
| 194 | 3300007083 | Ga0103261_1005741 | Ga0103261_10057412 | 306 |
| 195 | 3300007129 | Ga0102734_1019084 | Ga0102734_10190842 | 306 |
| 196 | 3300007142 | Ga0102737_1004673 | Ga0102737_10046732 | 306 |
| 197 | 3300007188 | Ga0103264_1000415 | Ga0103264_10004158 | 306 |
| 198 | 3300007188 | Ga0103264_1033925 | Ga0103264_10339253 | 306 |
| 199 | 3300007190 | Ga0103267_1000007 | Ga0103267_100000720 | 306 |
| 200 | 3300007192 | Ga0103268_1001129 | Ga0103268_10011297 | 306 |
| 201 | 3300010882 | Ga0123354_10144905 | Ga0123354_101449052 | 306 |
| 202 | 3300012829 | Ga0160467_101473 | Ga0160467_1014732 | 306 |
| 203 | 3300012845 | Ga0160460_100022 | Ga0160460_100022186 | 306 |
| 204 | 3300012849 | Ga0160447_100076 | Ga0160447_10007632 | 306 |
| 205 | 3300012849 | Ga0160447_100624 | Ga0160447_10062412 | 306 |
| 206 | 3300012850 | Ga0160434_100089 | Ga0160434_10008914 | 306 |
| 207 | 3300012854 | Ga0160448_106070 | Ga0160448_1060703 | 306 |
| 208 | 3300012857 | Ga0160435_1000052 | Ga0160435_100005245 | 306 |
| 209 | 3300012857 | Ga0160435_1001117 | Ga0160435_10011174 | 306 |
| 210 | 3300042602 | Ga0466713_012829 | Ga0466713_012829_45561_46481 | 306 |
| 211 | iso_pr_bacteria | 2900354037 | 2900355063 | 306 |
| 212 | iso_pr_bacteria | 8067483258 | 8067485134 | 306 |
| 213 | 3300042594 | Ga0466694_049318 | Ga0466694_049318_4091_5014 | 307 |
| 214 | 3300042618 | Ga0466723_249905 | Ga0466723_249905_362_1285 | 307 |
| 215 | 3300042655 | Ga0466727_127392 | Ga0466727_127392_3557_4480 | 307 |
| 216 | 3300012848 | Ga0160443_100030 | Ga0160443_10003090 | 308 |
| 217 | 3300038395 | Ga0415639_022410 | Ga0415639_022410_7758_8684 | 308 |
| 218 | iso_pr_bacteria | 2864808494 | 2864809651 | 308 |
| 219 | iso_pr_bacteria | 2864812326 | 2864813221 | 308 |
| 220 | iso_pr_bacteria | 2864859030 | 2864860445 | 308 |
| 221 | iso_pr_bacteria | 2864914039 | 2864915534 | 308 |
| 222 | iso_pr_bacteria | 2864988360 | 2864993031 | 308 |
| 223 | 3300012854 | Ga0160448_100472 | Ga0160448_1004724 | 309 |
| 224 | 3300042619 | Ga0466726_022307 | Ga0466726_022307_11941_12870 | 309 |
| 225 | 3300009826 | Ga0123355_10395488 | Ga0123355_103954882 | 310 |
| 226 | 3300012819 | Ga0160468_100146 | Ga0160468_10014652 | 311 |
| 227 | 3300042608 | Ga0466721_330899 | Ga0466721_330899_1072_2007 | 311 |
| 228 | 3300042614 | Ga0466712_195725 | Ga0466712_195725_1142_2077 | 311 |
| 229 | 3300042619 | Ga0466726_228701 | Ga0466726_228701_3328_4263 | 311 |
| 230 | 3300005201 | Ga0072941_1014622 | Ga0072941_10146222 | 312 |
| 231 | 3300009826 | Ga0123355_10727035 | Ga0123355_107270351 | 312 |
| 232 | 3300010049 | Ga0123356_10025736 | Ga0123356_100257363 | 312 |
| 233 | 3300010225 | Ga0136160_1000047 | Ga0136160_1000047555 | 312 |
| 234 | 3300009784 | Ga0123357_10107397 | Ga0123357_101073973 | 313 |
| 235 | 3300042620 | Ga0466728_301543 | Ga0466728_301543_3663_4607 | 314 |
| 236 | 3300042612 | Ga0466705_021724 | Ga0466705_021724_51343_52329 | 315 |
| 237 | 3300010049 | Ga0123356_10130292 | Ga0123356_101302922 | 316 |
| 238 | 3300002449 | JGI24698J34947_10066823 | JGI24698J34947_100668232 | 317 |
| 239 | 3300009826 | Ga0123355_10163694 | Ga0123355_101636942 | 320 |
| 240 | 3300007083 | Ga0103261_1000146 | Ga0103261_10001467 | 322 |
| 241 | 3300038395 | Ga0415639_116670 | Ga0415639_116670_710_1681 | 323 |
| 242 | 3300042613 | Ga0466710_401879 | Ga0466710_401879_114_1103 | 329 |
| 243 | 3300012805 | Ga0160464_100196 | Ga0160464_10019670 | 336 |
| 244 | 3300012809 | Ga0160466_102494 | Ga0160466_1024944 | 336 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01507 | PAPS_reduct | Phosphoadenosine phosphosulfate reductase family | 64 | 289 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01507 | GO:0003824 | catalytic activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.