Protein Family IF03612
Metagenome
Isolate
134
Members
72
Samples
100
Scaffolds
347.21
Avg Length
Representative Sequence
- ID
- 3300012809|Ga0160466_100073|Ga0160466_10007322
- Length
- 382 aa
- Sequence
- VTHTHHEPHDDDPDAGRARDGHALHGEYKVPGGKLVTVDLTVRAGVLDHVRVAGDFFLEPDEALVEIDAALTGLPADTTTSRLAEAVREHLAAAQDAGRLVGPVSMVGFDEHAVAVAVRRALGRSTTWADHTFEVIRPGPFAPALHAALDQVLTEELAAGRRGPTLRFWEWEEPAVIIGSFQSLRNEVDLEAAERYGITVVRRISGGGAMFMEAGNCITFSLVVPGSLVDGMTFEESYAFLNQWVLGALADVGVAATLSGLNDISSPGGKLAGSAQKRLVGGAVLHHVTMSYDIDAAKMLEVLRIGREKVSDKGTRSAAKRVDPVRSQTHLPRVDVIDAFEAHFRTHYPSVSGELRADELARAEQLRVHKFSDPAWTARVP*
Sample Types
Isolate
25.4%
Metagenome
74.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.8%
Termitidae
20.0%
Kalotermitidae
15.4%
Cambaridae
7.7%
Culicidae
7.7%
Scarabaeidae
4.6%
Hydrophilidae
3.1%
Rhinotermitidae
3.1%
Ixodidae
1.5%
Hodotermitidae
1.5%
Reduviidae
1.5%
Termopsidae
1.5%
Armadillidiidae
1.5%
Taxonomy
Archaea
0
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 2 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 3 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 4 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 5 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 6 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 7 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 10 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 11 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 17 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 18 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 19 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 20 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 21 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 28 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 29 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 30 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 31 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 32 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 36 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 37 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 38 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 39 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 40 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 49 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 50 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 51 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 52 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 53 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 54 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 60 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 61 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 67 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 70 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 71 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 72 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_170046 | 3300042611 | Bacteria | 2535 |
| 2 | Ga0466733_072257 | 3300042659 | Bacteria | 8315 |
| 3 | Ga0123357_10000457 | 3300009784 | Bacteria | 39518 |
| 4 | Ga0466715_172117 | 3300042616 | Bacteria | 21682 |
| 5 | Ga0160452_100211 | 3300012834 | Bacteria | 61762 |
| 6 | Ga0466692_062034 | 3300042591 | Bacteria | 12154 |
| 7 | Ga0466696_277875 | 3300042596 | Bacteria | 4888 |
| 8 | Ga0123356_10004461 | 3300010049 | Bacteria | 14469 |
| 9 | Ga0466700_108826 | 3300042600 | Bacteria | 11898 |
| 10 | Ga0466719_192771 | 3300042606 | Bacteria | 52306 |
| 11 | Ga0466704_360510 | 3300042643 | Bacteria | 7834 |
| 12 | Ga0466705_056325 | 3300042612 | Bacteria | 1842 |
| 13 | Ga0466733_102585 | 3300042659 | Bacteria | 133807 |
| 14 | JGI24699J35502_11133971 | 3300002509 | Bacteria | 21992 |
| 15 | Ga0123357_10000007 | 3300009784 | Bacteria | 257289 |
| 16 | Ga0466723_248139 | 3300042618 | Bacteria | 3716 |
| 17 | Ga0160452_100205 | 3300012834 | Bacteria | 63686 |
| 18 | Ga0160436_1000063 | 3300012861 | Bacteria | 56546 |
| 19 | Ga0123356_10000068 | 3300010049 | Bacteria | 108740 |
| 20 | Ga0123354_10080324 | 3300010882 | Bacteria | 4617 |
| 21 | Ga0160466_100073 | 3300012809 | Bacteria | 108791 |
| 22 | Ga0466707_302191 | 3300042601 | Bacteria | 41985 |
| 23 | Ga0466713_047200 | 3300042602 | Bacteria | 14547 |
| 24 | Ga0466703_138789 | 3300042636 | Bacteria | 30404 |
| 25 | Ga0466704_209805 | 3300042643 | Bacteria | 27042 |
| 26 | Ga0466705_376852 | 3300042612 | Bacteria | 2668 |
| 27 | Ga0123357_10003224 | 3300009784 | Bacteria | 18583 |
| 28 | Ga0466723_003291 | 3300042618 | Bacteria | 2985 |
| 29 | Ga0160459_109232 | 3300012831 | Bacteria | 1200 |
| 30 | Ga0123357_10008027 | 3300009784 | Bacteria | 13132 |
| 31 | Ga0123357_10035061 | 3300009784 | Bacteria | 6822 |
| 32 | Ga0123357_10082044 | 3300009784 | Bacteria | 4236 |
| 33 | Ga0466707_123567 | 3300042601 | Bacteria | 2012 |
| 34 | Ga0466727_269844 | 3300042655 | Bacteria | 2579 |
| 35 | JGI24705J35276_12235802 | 3300002504 | Bacteria | 6996 |
| 36 | Ga0123357_10000060 | 3300009784 | Bacteria | 86303 |
| 37 | Ga0466728_183102 | 3300042620 | Bacteria | 2788 |
| 38 | Ga0466728_185246 | 3300042620 | Bacteria | 1635 |
| 39 | Ga0160457_1000118 | 3300012858 | Bacteria | 101854 |
| 40 | Ga0123357_10008430 | 3300009784 | Bacteria | 12871 |
| 41 | Ga0123357_10036318 | 3300009784 | Bacteria | 6705 |
| 42 | Ga0123356_10014674 | 3300010049 | Unclassified | 7529 |
| 43 | Ga0123354_10007124 | 3300010882 | Unclassified | 16747 |
| 44 | Ga0123354_10024614 | 3300010882 | Bacteria | 9499 |
| 45 | Ga0123354_10058658 | 3300010882 | Bacteria | 5716 |
| 46 | Ga0466706_196894 | 3300042599 | Bacteria | 81884 |
| 47 | Ga0466713_062667 | 3300042602 | Bacteria | 5441 |
| 48 | Ga0466713_125509 | 3300042602 | Bacteria | 5634 |
| 49 | Ga0466698_047956 | 3300042610 | Bacteria | 3757 |
| 50 | Ga0466729_297056 | 3300042621 | Bacteria | 2625 |
| 51 | Ga0466730_014721 | 3300042625 | Bacteria | 1514 |
| 52 | JGI24699J35502_11051745 | 3300002509 | Bacteria | 1658 |
| 53 | JGI24699J35502_11130938 | 3300002509 | Bacteria | 5376 |
| 54 | Ga0466705_494940 | 3300042612 | Bacteria | 4601 |
| 55 | Ga0466723_012640 | 3300042618 | Bacteria | 4375 |
| 56 | Ga0160446_101319 | 3300012835 | Unclassified | 5520 |
| 57 | Ga0466696_178891 | 3300042596 | Bacteria | 9127 |
| 58 | Ga0466696_263774 | 3300042596 | Bacteria | 13022 |
| 59 | Ga0123356_10000416 | 3300010049 | Bacteria | 48609 |
| 60 | Ga0123356_10044930 | 3300010049 | Bacteria | 4111 |
| 61 | Ga0466703_012543 | 3300042636 | Bacteria | 6216 |
| 62 | Ga0466727_214504 | 3300042655 | Bacteria | 26007 |
| 63 | Ga0466727_278244 | 3300042655 | Bacteria | 8808 |
| 64 | Ga0123357_10002981 | 3300009784 | Bacteria | 19160 |
| 65 | Ga0466728_128283 | 3300042620 | Bacteria | 1677 |
| 66 | Ga0160432_101423 | 3300012818 | Bacteria | 7742 |
| 67 | Ga0160458_100841 | 3300012832 | Unclassified | 8623 |
| 68 | Ga0466693_109461 | 3300042592 | Bacteria | 182600 |
| 69 | Ga0466691_019078 | 3300042593 | Bacteria | 4608 |
| 70 | Ga0123356_10019724 | 3300010049 | Bacteria | 6390 |
| 71 | Ga0123354_10019423 | 3300010882 | Bacteria | 10673 |
| 72 | Ga0123354_10181713 | 3300010882 | Bacteria | 2398 |
| 73 | Ga0160442_100234 | 3300012806 | Bacteria | 40858 |
| 74 | Ga0466707_042725 | 3300042601 | Bacteria | 3927 |
| 75 | Ga0466707_215665 | 3300042601 | Bacteria | 13524 |
| 76 | Ga0466717_118770 | 3300042604 | Bacteria | 9535 |
| 77 | Ga0466708_410670 | 3300042652 | Bacteria | 1626 |
| 78 | Ga0466723_036694 | 3300042618 | Bacteria | 6437 |
| 79 | Ga0466728_358286 | 3300042620 | Bacteria | 1444 |
| 80 | Ga0160447_101836 | 3300012849 | Bacteria | 7882 |
| 81 | Ga0466657_158735 | 3300042582 | Bacteria | 2387 |
| 82 | Ga0466696_040705 | 3300042596 | Bacteria | 12078 |
| 83 | Ga0466696_448525 | 3300042596 | Bacteria | 8153 |
| 84 | Ga0123357_10095316 | 3300009784 | Bacteria | 3859 |
| 85 | Ga0123357_10344843 | 3300009784 | Bacteria | 1434 |
| 86 | Ga0123354_10045360 | 3300010882 | Bacteria | 6728 |
| 87 | Ga0466707_316054 | 3300042601 | Bacteria | 2224 |
| 88 | Ga0466713_143179 | 3300042602 | Bacteria | 4964 |
| 89 | Ga0466703_048402 | 3300042636 | Bacteria | 91221 |
| 90 | Ga0466708_252439 | 3300042652 | Bacteria | 3344 |
| 91 | Ga0466705_107046 | 3300042612 | Bacteria | 8347 |
| 92 | Ga0466693_258072 | 3300042592 | Bacteria | 38272 |
| 93 | Ga0123357_10090326 | 3300009784 | Bacteria | 3995 |
| 94 | Ga0123356_10014325 | 3300010049 | Bacteria | 7628 |
| 95 | Ga0123354_10040603 | 3300010882 | Bacteria | 7199 |
| 96 | Ga0466706_166351 | 3300042599 | Bacteria | 10416 |
| 97 | Ga0466700_066366 | 3300042600 | Bacteria | 1311 |
| 98 | Ga0466713_044790 | 3300042602 | Bacteria | 5559 |
| 99 | Ga0466703_342396 | 3300042636 | Bacteria | 7220 |
| 100 | Ga0466704_046112 | 3300042643 | Bacteria | 12478 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820944107 | 2820944295 | 312 |
| 2 | 3300042612 | Ga0466705_376852 | Ga0466705_376852_1639_2652 | 316 |
| 3 | 3300042593 | Ga0466691_019078 | Ga0466691_019078_1240_2289 | 319 |
| 4 | 3300010882 | Ga0123354_10181713 | Ga0123354_101817132 | 321 |
| 5 | 3300042601 | Ga0466707_123567 | Ga0466707_123567_169_1218 | 322 |
| 6 | 3300042643 | Ga0466704_360510 | Ga0466704_360510_1651_2631 | 326 |
| 7 | 3300042636 | Ga0466703_138789 | Ga0466703_138789_7249_8298 | 327 |
| 8 | 3300010882 | Ga0123354_10007124 | Ga0123354_1000712411 | 329 |
| 9 | 3300042596 | Ga0466696_277875 | Ga0466696_277875_536_1585 | 329 |
| 10 | 3300042601 | Ga0466707_042725 | Ga0466707_042725_1805_2854 | 329 |
| 11 | 3300042602 | Ga0466713_143179 | Ga0466713_143179_1692_2741 | 329 |
| 12 | 3300042606 | Ga0466719_192771 | Ga0466719_192771_35983_37032 | 329 |
| 13 | 3300042612 | Ga0466705_056325 | Ga0466705_056325_449_1498 | 329 |
| 14 | 3300042616 | Ga0466715_172117 | Ga0466715_172117_14438_15487 | 329 |
| 15 | 3300042618 | Ga0466723_003291 | Ga0466723_003291_173_1222 | 329 |
| 16 | 3300042618 | Ga0466723_036694 | Ga0466723_036694_2814_3863 | 329 |
| 17 | 3300042618 | Ga0466723_248139 | Ga0466723_248139_692_1741 | 329 |
| 18 | 3300042620 | Ga0466728_183102 | Ga0466728_183102_668_1717 | 329 |
| 19 | 3300042636 | Ga0466703_048402 | Ga0466703_048402_35634_36683 | 329 |
| 20 | 3300042652 | Ga0466708_252439 | Ga0466708_252439_1177_2226 | 329 |
| 21 | 3300042652 | Ga0466708_410670 | Ga0466708_410670_165_1214 | 329 |
| 22 | 3300042602 | Ga0466713_044790 | Ga0466713_044790_40_1089 | 331 |
| 23 | 3300042602 | Ga0466713_062667 | Ga0466713_062667_1533_2582 | 331 |
| 24 | 3300042602 | Ga0466713_125509 | Ga0466713_125509_1114_2163 | 331 |
| 25 | 3300042612 | Ga0466705_107046 | Ga0466705_107046_6197_7246 | 331 |
| 26 | 3300042618 | Ga0466723_012640 | Ga0466723_012640_1953_3002 | 331 |
| 27 | 3300042620 | Ga0466728_128283 | Ga0466728_128283_52_1101 | 331 |
| 28 | 3300010882 | Ga0123354_10040603 | Ga0123354_100406034 | 333 |
| 29 | 3300010049 | Ga0123356_10000416 | Ga0123356_1000041623 | 335 |
| 30 | 3300042643 | Ga0466704_209805 | Ga0466704_209805_19982_21031 | 336 |
| 31 | 3300002509 | JGI24699J35502_11051745 | JGI24699J35502_110517452 | 337 |
| 32 | 3300042620 | Ga0466728_358286 | Ga0466728_358286_284_1297 | 337 |
| 33 | 3300042636 | Ga0466703_342396 | Ga0466703_342396_1318_2397 | 337 |
| 34 | 3300002509 | JGI24699J35502_11130938 | JGI24699J35502_111309383 | 338 |
| 35 | 3300009784 | Ga0123357_10003224 | Ga0123357_1000322410 | 338 |
| 36 | 3300010049 | Ga0123356_10004461 | Ga0123356_100044619 | 339 |
| 37 | 3300010049 | Ga0123356_10044930 | Ga0123356_100449302 | 339 |
| 38 | 3300042655 | Ga0466727_214504 | Ga0466727_214504_17392_18441 | 340 |
| 39 | 3300042655 | Ga0466727_278244 | Ga0466727_278244_4967_6025 | 341 |
| 40 | 3300042611 | Ga0466697_170046 | Ga0466697_170046_1031_2122 | 343 |
| 41 | 3300042610 | Ga0466698_047956 | Ga0466698_047956_2089_3141 | 344 |
| 42 | 3300012834 | Ga0160452_100211 | Ga0160452_10021136 | 345 |
| 43 | 3300042621 | Ga0466729_297056 | Ga0466729_297056_942_2018 | 346 |
| 44 | 3300042659 | Ga0466733_102585 | Ga0466733_102585_36784_37824 | 346 |
| 45 | 3300042600 | Ga0466700_066366 | Ga0466700_066366_175_1242 | 347 |
| 46 | 3300042582 | Ga0466657_158735 | Ga0466657_158735_866_1915 | 349 |
| 47 | 3300042599 | Ga0466706_196894 | Ga0466706_196894_11913_12962 | 349 |
| 48 | 3300042600 | Ga0466700_108826 | Ga0466700_108826_7669_8718 | 349 |
| 49 | 3300042601 | Ga0466707_215665 | Ga0466707_215665_11737_12786 | 349 |
| 50 | 3300042601 | Ga0466707_302191 | Ga0466707_302191_22506_23555 | 349 |
| 51 | 3300042601 | Ga0466707_316054 | Ga0466707_316054_557_1606 | 349 |
| 52 | 3300042602 | Ga0466713_047200 | Ga0466713_047200_13422_14471 | 349 |
| 53 | 3300042604 | Ga0466717_118770 | Ga0466717_118770_7295_8344 | 349 |
| 54 | 3300042612 | Ga0466705_494940 | Ga0466705_494940_374_1423 | 349 |
| 55 | 3300042620 | Ga0466728_185246 | Ga0466728_185246_156_1205 | 349 |
| 56 | 3300042659 | Ga0466733_072257 | Ga0466733_072257_6537_7586 | 349 |
| 57 | iso_pr_bacteria | 2545824723 | 2546570697 | 349 |
| 58 | iso_pr_bacteria | 2681812870 | 2682013643 | 349 |
| 59 | iso_pr_bacteria | 2820816657 | 2820816987 | 349 |
| 60 | iso_pr_bacteria | 2820816657 | 2820818387 | 349 |
| 61 | iso_pr_bacteria | 2820829137 | 2820829618 | 349 |
| 62 | iso_pr_bacteria | 2820901319 | 2820901745 | 349 |
| 63 | iso_pr_bacteria | 2820911766 | 2820913615 | 349 |
| 64 | iso_pr_bacteria | 2820914081 | 2820915215 | 349 |
| 65 | iso_pr_bacteria | 2837204985 | 2837206347 | 349 |
| 66 | iso_pr_bacteria | 2873558832 | 2873560013 | 349 |
| 67 | iso_pr_bacteria | 2909412500 | 2909415426 | 349 |
| 68 | iso_pr_bacteria | 2931430189 | 2931430634 | 349 |
| 69 | 3300009784 | Ga0123357_10000007 | Ga0123357_10000007194 | 350 |
| 70 | 3300009784 | Ga0123357_10090326 | Ga0123357_100903262 | 350 |
| 71 | 3300009784 | Ga0123357_10344843 | Ga0123357_103448431 | 350 |
| 72 | 3300010049 | Ga0123356_10014674 | Ga0123356_100146742 | 350 |
| 73 | 3300010049 | Ga0123356_10019724 | Ga0123356_100197245 | 350 |
| 74 | 3300010882 | Ga0123354_10019423 | Ga0123354_1001942313 | 350 |
| 75 | 3300012858 | Ga0160457_1000118 | Ga0160457_100011846 | 350 |
| 76 | 3300012861 | Ga0160436_1000063 | Ga0160436_100006317 | 350 |
| 77 | 3300042599 | Ga0466706_166351 | Ga0466706_166351_8553_9605 | 350 |
| 78 | 3300010882 | Ga0123354_10024614 | Ga0123354_100246146 | 351 |
| 79 | 3300010882 | Ga0123354_10080324 | Ga0123354_100803244 | 351 |
| 80 | iso_pr_bacteria | 2873586004 | 2873588051 | 351 |
| 81 | iso_pr_bacteria | 2915166107 | 2915167201 | 351 |
| 82 | iso_pr_bacteria | 2915168811 | 2915171546 | 351 |
| 83 | 3300009784 | Ga0123357_10000060 | Ga0123357_1000006025 | 352 |
| 84 | 3300009784 | Ga0123357_10082044 | Ga0123357_100820445 | 352 |
| 85 | 3300042596 | Ga0466696_040705 | Ga0466696_040705_9394_10452 | 352 |
| 86 | 3300042625 | Ga0466730_014721 | Ga0466730_014721_45_1103 | 352 |
| 87 | 3300042636 | Ga0466703_012543 | Ga0466703_012543_2681_3739 | 352 |
| 88 | 3300042596 | Ga0466696_178891 | Ga0466696_178891_4172_5233 | 353 |
| 89 | 3300042596 | Ga0466696_263774 | Ga0466696_263774_10185_11246 | 353 |
| 90 | 3300042591 | Ga0466692_062034 | Ga0466692_062034_7704_8768 | 354 |
| 91 | iso_pr_bacteria | 2515154104 | 2515589677 | 354 |
| 92 | iso_pr_bacteria | 2912817845 | 2912821003 | 354 |
| 93 | iso_pr_bacteria | 3006667155 | 3006670360 | 354 |
| 94 | iso_pr_bacteria | 8062637095 | 8062637245 | 354 |
| 95 | iso_pr_bacteria | 8062747827 | 8062750948 | 354 |
| 96 | 3300009784 | Ga0123357_10036318 | Ga0123357_100363182 | 355 |
| 97 | 3300042655 | Ga0466727_269844 | Ga0466727_269844_388_1524 | 355 |
| 98 | iso_pr_bacteria | 2820922474 | 2820923298 | 355 |
| 99 | 3300002504 | JGI24705J35276_12235802 | JGI24705J35276_122358022 | 356 |
| 100 | 3300002509 | JGI24699J35502_11133971 | JGI24699J35502_1113397111 | 356 |
| 101 | 3300010049 | Ga0123356_10014325 | Ga0123356_100143256 | 356 |
| 102 | iso_pr_bacteria | 2820814774 | 2820816318 | 356 |
| 103 | iso_pr_bacteria | 2821314491 | 2821315864 | 357 |
| 104 | 3300009784 | Ga0123357_10002981 | Ga0123357_100029818 | 358 |
| 105 | 3300009784 | Ga0123357_10008027 | Ga0123357_100080277 | 358 |
| 106 | 3300010882 | Ga0123354_10045360 | Ga0123354_100453604 | 358 |
| 107 | iso_pr_bacteria | 2504756063 | 2504978768 | 358 |
| 108 | iso_pr_bacteria | 2505679068 | 2505953297 | 358 |
| 109 | iso_pr_bacteria | 2820825283 | 2820826220 | 358 |
| 110 | iso_pr_bacteria | 2820849606 | 2820851526 | 358 |
| 111 | iso_pr_bacteria | 2820909719 | 2820910372 | 358 |
| 112 | iso_pr_bacteria | 2820926697 | 2820927793 | 358 |
| 113 | iso_pr_bacteria | 2848356102 | 2848357748 | 358 |
| 114 | 3300010049 | Ga0123356_10000068 | Ga0123356_1000006870 | 359 |
| 115 | 3300010882 | Ga0123354_10058658 | Ga0123354_100586585 | 359 |
| 116 | 3300012806 | Ga0160442_100234 | Ga0160442_1002344 | 359 |
| 117 | 3300012832 | Ga0160458_100841 | Ga0160458_1008416 | 359 |
| 118 | 3300012834 | Ga0160452_100205 | Ga0160452_10020552 | 359 |
| 119 | 3300012835 | Ga0160446_101319 | Ga0160446_1013195 | 359 |
| 120 | 3300012849 | Ga0160447_101836 | Ga0160447_1018366 | 359 |
| 121 | 3300042592 | Ga0466693_109461 | Ga0466693_109461_89386_90495 | 359 |
| 122 | 3300042592 | Ga0466693_258072 | Ga0466693_258072_14245_15390 | 359 |
| 123 | 3300009784 | Ga0123357_10000457 | Ga0123357_100004578 | 360 |
| 124 | 3300009784 | Ga0123357_10035061 | Ga0123357_100350615 | 360 |
| 125 | 3300009784 | Ga0123357_10095316 | Ga0123357_100953163 | 360 |
| 126 | 3300012818 | Ga0160432_101423 | Ga0160432_1014234 | 361 |
| 127 | iso_pr_bacteria | 2731957681 | 2732700025 | 361 |
| 128 | 3300009784 | Ga0123357_10008430 | Ga0123357_100084305 | 363 |
| 129 | 3300012831 | Ga0160459_109232 | Ga0160459_1092321 | 364 |
| 130 | iso_pr_bacteria | 2820897376 | 2820899651 | 365 |
| 131 | 3300042596 | Ga0466696_448525 | Ga0466696_448525_6606_7709 | 367 |
| 132 | iso_pr_bacteria | 2862075925 | 2862076470 | 367 |
| 133 | 3300042643 | Ga0466704_046112 | Ga0466704_046112_5954_7159 | 381 |
| 134 | 3300012809 | Ga0160466_100073 | Ga0160466_10007322 | 382 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03099 | GO:0036211 | protein modification process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.