Protein Family IF03597

Metagenome Isolate
135 Members
71 Samples
118 Scaffolds
184.07 Avg Length

🧬 Representative Sequence

ID
3300012805|Ga0160464_101916|Ga0160464_1019162
Length
201 aa
Sequence
MIRIRIDYNDKLQNILIRMNAIETKLKGCFILEPKVFDDSRGYFFESFNEENFERLTGQNGHFVQDNQSSSTYGVVRGLHFQKGEYAQAKLVRVLEGSVLDVAVDIRENSATFGQWISIELSESNNRQLYIPRGFAHGFSVLSETAVFAYKCDNKYHKESEGGIKYNDPDLNIDWGIPDVSMVLSDKDDILPFLKECSLN*

📊 Sample Types

Isolate 12.6%
Metagenome 87.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 16.7%
Unclassified 10.6%
Elmidae 7.6%
Apidae 6.1%
Rhinotermitidae 4.5%
Passalidae 3.0%
Termopsidae 3.0%
Culicidae 3.0%
Armadillidiidae 3.0%
Blattidae 1.5%
Daphniidae 1.5%
Nephropidae 1.5%
Curculionidae 1.5%
Drosophilidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
13 8052469819 Pseudomonas putida DZ-F23 Isolate
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
18 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
19 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 2820064859 Unclassified Proteobacteria Nt197P3bin78 Isolate Unclassified
22 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
25 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
26 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
27 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
28 2832372155 Apibacter adventoris wkB301 Isolate Apidae
29 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
30 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
31 2920168565 Paludibacter sp. 221 Isolate Blattidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
35 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
36 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
37 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
38 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
39 2820097052 Unclassified Proteobacteria Lab288P3bin109 Isolate Unclassified
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
50 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
51 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
52 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
53 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
54 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
55 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2832343623 Apibacter adventoris wkB180 Isolate Apidae
61 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
62 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
63 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
64 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
65 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
66 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
67 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
68 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
69 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
70 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
71 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_286694 3300042612 Bacteria 89956
2 Ga0466715_249241 3300042616 Bacteria 13546
3 Ga0123356_10202511 3300010049 Bacteria 2026
4 Ga0466690_010392 3300042590 Bacteria 6879
5 Ga0466691_135341 3300042593 Bacteria 5838
6 Ga0466707_034830 3300042601 Bacteria 9732
7 Ga0466707_044020 3300042601 Bacteria 10192
8 Ga0466722_191859 3300042609 Bacteria 8459
9 Ga0466724_60511 3300042649 Bacteria 10953
10 Ga0466705_269431 3300042612 Bacteria 5804
11 IMNBL1DRAFT_c0014616 3300000062 Bacteria 3451
12 Ga0068305_10001985 3300005083 Bacteria 26411
13 Ga0466705_390434 3300042612 Bacteria 7696
14 Ga0123353_10493983 3300010167 Bacteria 1786
15 Ga0123353_10566365 3300010167 Bacteria 1634
16 Ga0123353_11135401 3300010167 Bacteria 1033
17 Ga0123353_11152858 3300010167 Bacteria 1023
18 Ga0466690_068829 3300042590 Bacteria 4206
19 Ga0466693_035063 3300042592 Bacteria 7940
20 Ga0466696_023356 3300042596 Unclassified 1157
21 Ga0466699_107554 3300042597 Bacteria 27463
22 Ga0466706_258993 3300042599 Bacteria 1969
23 Ga0466716_278774 3300042605 Bacteria 6798
24 Ga0466716_408831 3300042605 Bacteria 19240
25 Ga0466731_004182 3300042622 Bacteria 4674
26 Ga0466703_260349 3300042636 Bacteria 2728
27 Ga0466724_37932 3300042649 Bacteria 325221
28 Ga0466733_208928 3300042659 Bacteria 3770
29 Ga0466723_370512 3300042618 Bacteria 1635
30 Ga0123353_10433704 3300010167 Bacteria 1942
31 Ga0123353_10940420 3300010167 Bacteria 1171
32 Ga0466657_003042 3300042582 Bacteria 3667
33 Ga0466696_001659 3300042596 Bacteria 3819
34 Ga0466714_045987 3300042603 Bacteria 4831
35 Ga0466717_016088 3300042604 Bacteria 1004
36 Ga0466697_124245 3300042611 Bacteria 1117
37 Ga0466733_061622 3300042659 Bacteria 45413
38 Ga0466733_210212 3300042659 Bacteria 6053
39 JGI24696J40584_12961452 3300002834 Bacteria 16577
40 Ga0068305_10015395 3300005083 Bacteria 16031
41 Ga0104019_1000703 3300007150 Bacteria 6431
42 Ga0466705_487754 3300042612 Bacteria 2750
43 Ga0466726_165686 3300042619 Bacteria 20812
44 Ga0466726_274446 3300042619 Bacteria 18585
45 Ga0466726_370725 3300042619 Bacteria 3140
46 Ga0123353_10078507 3300010167 Bacteria 5305
47 Ga0123353_10216844 3300010167 Bacteria 2996
48 Ga0160458_100059 3300012832 Bacteria 140854
49 Ga0466691_077057 3300042593 Bacteria 30107
50 Ga0466695_210473 3300042595 Bacteria 1026
51 Ga0466696_467231 3300042596 Bacteria 36934
52 Ga0466707_218601 3300042601 Bacteria 2454
53 Ga0466707_321532 3300042601 Bacteria 5733
54 Ga0466714_018142 3300042603 Bacteria 29534
55 Ga0466714_101114 3300042603 Bacteria 64102
56 Ga0466730_103184 3300042625 Bacteria 430539
57 Ga0466724_52458 3300042649 Bacteria 1426
58 JGI24705J35276_12230140 3300002504 Bacteria 3553
59 Ga0074278_113765 3300005721 Bacteria 4053
60 Ga0466726_183338 3300042619 Bacteria 6105
61 Ga0466726_349613 3300042619 Bacteria 17660
62 Ga0160465_100266 3300012803 Bacteria 36725
63 Ga0466696_193266 3300042596 Bacteria 3001
64 Ga0466716_174391 3300042605 Bacteria 2271
65 Ga0466734_010201 3300042623 Bacteria 1934
66 Ga0466732_372506 3300042656 Bacteria 121204
67 2227480194 2225789004 Bacteria 22279
68 IMNBL1DRAFT_c0041921 3300000062 Bacteria 1531
69 HBC_ctgsDRAFT_1114310 3300000333 Bacteria 615
70 Ga0466711_048450 3300042615 Bacteria 15905
71 Ga0466723_255763 3300042618 Bacteria 21019
72 Ga0466729_157132 3300042621 Bacteria 5109
73 Ga0123357_10497168 3300009784 Bacteria 1016
74 Ga0123353_10108093 3300010167 Bacteria 4483
75 Ga0123353_10307308 3300010167 Bacteria 2416
76 Ga0123353_10564152 3300010167 Bacteria 1638
77 Ga0123353_11006640 3300010167 Bacteria 1119
78 Ga0123353_11039106 3300010167 Bacteria 1096
79 Ga0123354_10272361 3300010882 Bacteria 1663
80 Ga0160466_100065 3300012809 Bacteria 124006
81 Ga0160468_100032 3300012819 Bacteria 245980
82 Ga0264413_105539 3300024493 Bacteria 56200
83 Ga0466693_160925 3300042592 Bacteria 1157
84 Ga0466691_020432 3300042593 Bacteria 3558
85 Ga0466696_123970 3300042596 Bacteria 2882
86 Ga0466696_370919 3300042596 Bacteria 8592
87 Ga0466701_090323 3300042598 Bacteria 3745
88 Ga0466706_129705 3300042599 Bacteria 95744
89 Ga0466711_115138 3300042615 Bacteria 5162
90 Ga0466711_275598 3300042615 Bacteria 8503
91 Ga0466726_063830 3300042619 Bacteria 1692
92 Ga0123356_11893925 3300010049 Bacteria 742
93 Ga0123353_10529145 3300010167 Bacteria 1707
94 Ga0123354_10598592 3300010882 Bacteria 809
95 Ga0160467_100236 3300012829 Bacteria 68849
96 Ga0415639_014088 3300038395 Bacteria 5610
97 Ga0466695_266854 3300042595 Bacteria 2376
98 Ga0466696_031756 3300042596 Bacteria 22913
99 Ga0466699_127381 3300042597 Bacteria 84968
100 Ga0466701_009184 3300042598 Bacteria 202780
101 Ga0466706_215780 3300042599 Bacteria 1714
102 Ga0466719_034409 3300042606 Bacteria 46165
103 Ga0466722_163840 3300042609 Bacteria 5475
104 Ga0466734_062351 3300042623 Bacteria 1219
105 Ga0466734_070646 3300042623 Bacteria 5698
106 Ga0466735_081119 3300042624 Bacteria 2388
107 Ga0466709_228030 3300042648 Bacteria 70316
108 Ga0466724_05904 3300042649 Bacteria 45676
109 Ga0466724_30782 3300042649 Bacteria 270519
110 JGI24702J35022_10130224 3300002462 Bacteria 1396
111 Ga0466715_464138 3300042616 Bacteria 8287
112 Ga0123353_10099269 3300010167 Bacteria 4692
113 Ga0160464_101916 3300012805 Bacteria 4997
114 Ga0160460_100028 3300012845 Bacteria 325620
115 Ga0466692_050403 3300042591 Bacteria 54496
116 Ga0466691_061511 3300042593 Bacteria 6315
117 Ga0466706_157960 3300042599 Bacteria 4799
118 Ga0466703_424805 3300042636 Bacteria 1725

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_001659 Ga0466696_001659_34_516 160
2 3300042659 Ga0466733_208928 Ga0466733_208928_1495_2022 175
3 3300042609 Ga0466722_191859 Ga0466722_191859_7764_8294 176
4 3300042622 Ga0466731_004182 Ga0466731_004182_1085_1615 176
5 3300042596 Ga0466696_023356 Ga0466696_023356_228_761 177
6 3300042596 Ga0466696_031756 Ga0466696_031756_757_1290 177
7 3300042596 Ga0466696_370919 Ga0466696_370919_731_1264 177
8 3300042603 Ga0466714_045987 Ga0466714_045987_2900_3433 177
9 3300009784 Ga0123357_10497168 Ga0123357_104971681 179
10 3300012832 Ga0160458_100059 Ga0160458_10005986 179
11 3300024493 Ga0264413_105539 Ga0264413_10553954 179
12 3300042599 Ga0466706_129705 Ga0466706_129705_23004_23543 179
13 3300042601 Ga0466707_034830 Ga0466707_034830_6684_7223 179
14 3300042609 Ga0466722_163840 Ga0466722_163840_1798_2340 180
15 3300042619 Ga0466726_274446 Ga0466726_274446_12319_12861 180
16 3300042659 Ga0466733_210212 Ga0466733_210212_4258_4800 180
17 iso_pr_bacteria 2894649344 2894649887 180
18 3300042582 Ga0466657_003042 Ga0466657_003042_133_678 181
19 3300042619 Ga0466726_063830 Ga0466726_063830_1108_1653 181
20 3300042636 Ga0466703_424805 Ga0466703_424805_431_976 181
21 3300042649 Ga0466724_05904 Ga0466724_05904_32955_33500 181
22 3300042649 Ga0466724_30782 Ga0466724_30782_162884_163429 181
23 3300042649 Ga0466724_37932 Ga0466724_37932_136246_136791 181
24 iso_pr_bacteria 2838772460 2838775545 181
25 iso_pr_bacteria 2864788197 2864789057 181
26 iso_pr_bacteria 2864923010 2864923869 181
27 iso_pr_bacteria 2864948220 2864949079 181
28 iso_pr_bacteria 3007478678 3007480342 181
29 iso_pr_bacteria 8052469819 8052470529 181
30 3300012803 Ga0160465_100266 Ga0160465_10026616 182
31 3300042590 Ga0466690_068829 Ga0466690_068829_2611_3159 182
32 3300042595 Ga0466695_210473 Ga0466695_210473_294_842 182
33 3300042595 Ga0466695_266854 Ga0466695_266854_883_1431 182
34 3300042596 Ga0466696_467231 Ga0466696_467231_6928_7476 182
35 3300042599 Ga0466706_215780 Ga0466706_215780_881_1429 182
36 3300042601 Ga0466707_044020 Ga0466707_044020_6380_6928 182
37 3300042603 Ga0466714_018142 Ga0466714_018142_488_1036 182
38 3300042605 Ga0466716_174391 Ga0466716_174391_220_768 182
39 3300042616 Ga0466715_464138 Ga0466715_464138_4979_5527 182
40 3300042619 Ga0466726_370725 Ga0466726_370725_1754_2302 182
41 3300042636 Ga0466703_260349 Ga0466703_260349_1792_2340 182
42 3300042648 Ga0466709_228030 Ga0466709_228030_49971_50519 182
43 3300042656 Ga0466732_372506 Ga0466732_372506_74581_75129 182
44 iso_pr_bacteria 2811995047 2812947343 182
45 iso_pr_bacteria 2820789850 2820792483 182
46 iso_pr_bacteria 2864878056 2864881732 182
47 iso_pr_bacteria 2864886855 2864890630 182
48 3300000062 IMNBL1DRAFT_c0014616 IMNBL1DRAFT_00146162 183
49 3300000062 IMNBL1DRAFT_c0041921 IMNBL1DRAFT_00419211 183
50 3300002462 JGI24702J35022_10130224 JGI24702J35022_101302242 183
51 3300002834 JGI24696J40584_12961452 JGI24696J40584_129614524 183
52 3300010167 Ga0123353_10433704 Ga0123353_104337042 183
53 3300010882 Ga0123354_10598592 Ga0123354_105985921 183
54 3300042592 Ga0466693_035063 Ga0466693_035063_7040_7591 183
55 3300042593 Ga0466691_020432 Ga0466691_020432_70_621 183
56 3300042623 Ga0466734_010201 Ga0466734_010201_368_919 183
57 iso_pr_bacteria 2820097052 2820097322 183
58 iso_pr_bacteria 2920168565 2920170385 183
59 3300010167 Ga0123353_10564152 Ga0123353_105641522 184
60 3300010882 Ga0123354_10272361 Ga0123354_102723613 184
61 3300042593 Ga0466691_061511 Ga0466691_061511_4819_5373 184
62 3300042593 Ga0466691_135341 Ga0466691_135341_3682_4236 184
63 3300042598 Ga0466701_009184 Ga0466701_009184_157821_158375 184
64 3300042599 Ga0466706_258993 Ga0466706_258993_1334_1888 184
65 3300042601 Ga0466707_218601 Ga0466707_218601_1121_1675 184
66 3300042603 Ga0466714_101114 Ga0466714_101114_58140_58694 184
67 3300042605 Ga0466716_278774 Ga0466716_278774_1095_1649 184
68 3300042605 Ga0466716_408831 Ga0466716_408831_9818_10372 184
69 3300042606 Ga0466719_034409 Ga0466719_034409_11371_11925 184
70 3300042612 Ga0466705_269431 Ga0466705_269431_5014_5568 184
71 3300042612 Ga0466705_487754 Ga0466705_487754_1247_1801 184
72 3300042615 Ga0466711_048450 Ga0466711_048450_11143_11697 184
73 3300042615 Ga0466711_115138 Ga0466711_115138_2466_3020 184
74 3300042616 Ga0466715_249241 Ga0466715_249241_9354_9908 184
75 3300042618 Ga0466723_370512 Ga0466723_370512_677_1231 184
76 3300042619 Ga0466726_165686 Ga0466726_165686_15389_15943 184
77 3300042619 Ga0466726_349613 Ga0466726_349613_3275_3829 184
78 3300042623 Ga0466734_070646 Ga0466734_070646_2355_2909 184
79 3300042625 Ga0466730_103184 Ga0466730_103184_383855_384409 184
80 3300042649 Ga0466724_52458 Ga0466724_52458_306_860 184
81 3300042649 Ga0466724_60511 Ga0466724_60511_2226_2780 184
82 3300042659 Ga0466733_061622 Ga0466733_061622_39595_40149 184
83 iso_pr_bacteria 2832343623 2832345790 184
84 iso_pr_bacteria 2832372155 2832372458 184
85 3300010049 Ga0123356_11893925 Ga0123356_118939251 185
86 3300010167 Ga0123353_10078507 Ga0123353_100785073 185
87 3300010167 Ga0123353_10216844 Ga0123353_102168441 185
88 3300010167 Ga0123353_11152858 Ga0123353_111528582 185
89 3300012809 Ga0160466_100065 Ga0160466_10006582 185
90 3300012819 Ga0160468_100032 Ga0160468_100032114 185
91 3300012829 Ga0160467_100236 Ga0160467_1002367 185
92 3300042593 Ga0466691_077057 Ga0466691_077057_14618_15175 185
93 3300042596 Ga0466696_123970 Ga0466696_123970_2123_2680 185
94 3300042596 Ga0466696_193266 Ga0466696_193266_2428_2985 185
95 3300042598 Ga0466701_090323 Ga0466701_090323_1820_2377 185
96 3300042601 Ga0466707_321532 Ga0466707_321532_2227_2784 185
97 3300042612 Ga0466705_390434 Ga0466705_390434_4860_5417 185
98 3300042615 Ga0466711_275598 Ga0466711_275598_1386_1943 185
99 3300042619 Ga0466726_183338 Ga0466726_183338_1052_1609 185
100 3300042621 Ga0466729_157132 Ga0466729_157132_4302_4859 185
101 iso_pr_bacteria 642555127 642611342 185
102 3300010167 Ga0123353_10108093 Ga0123353_101080933 186
103 3300010167 Ga0123353_10307308 Ga0123353_103073083 186
104 3300010167 Ga0123353_11135401 Ga0123353_111354012 186
105 3300042590 Ga0466690_010392 Ga0466690_010392_3762_4322 186
106 3300042591 Ga0466692_050403 Ga0466692_050403_6737_7297 186
107 3300042604 Ga0466717_016088 Ga0466717_016088_336_896 186
108 3300042611 Ga0466697_124245 Ga0466697_124245_231_791 186
109 3300042618 Ga0466723_255763 Ga0466723_255763_10011_10571 186
110 3300042623 Ga0466734_062351 Ga0466734_062351_241_801 186
111 3300002504 JGI24705J35276_12230140 JGI24705J35276_122301402 187
112 3300007150 Ga0104019_1000703 Ga0104019_10007032 187
113 3300010049 Ga0123356_10202511 Ga0123356_102025112 187
114 3300010167 Ga0123353_10099269 Ga0123353_100992692 187
115 3300010167 Ga0123353_10493983 Ga0123353_104939833 187
116 3300010167 Ga0123353_10529145 Ga0123353_105291452 187
117 3300010167 Ga0123353_10566365 Ga0123353_105663652 187
118 3300010167 Ga0123353_10940420 Ga0123353_109404202 187
119 3300010167 Ga0123353_11006640 Ga0123353_110066402 187
120 3300010167 Ga0123353_11039106 Ga0123353_110391062 187
121 3300042592 Ga0466693_160925 Ga0466693_160925_156_719 187
122 3300038395 Ga0415639_014088 Ga0415639_014088_3717_4283 188
123 2225789004 2227480194 2227939426 189
124 3300012845 Ga0160460_100028 Ga0160460_100028144 189
125 3300042612 Ga0466705_286694 Ga0466705_286694_82325_82897 190
126 3300042624 Ga0466735_081119 Ga0466735_081119_1592_2164 190
127 3300005083 Ga0068305_10001985 Ga0068305_1000198516 191
128 3300042597 Ga0466699_127381 Ga0466699_127381_39998_40576 192
129 3300042597 Ga0466699_107554 Ga0466699_107554_24630_25211 193
130 3300042599 Ga0466706_157960 Ga0466706_157960_2053_2634 193
131 3300000333 HBC_ctgsDRAFT_1114310 HBC_ctgsDRAFT_11143101 194
132 3300005083 Ga0068305_10015395 Ga0068305_100153954 194
133 3300005721 Ga0074278_113765 Ga0074278_1137653 194
134 3300012805 Ga0160464_101916 Ga0160464_1019162 201
135 iso_pr_bacteria 2820064859 2820065501 221

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase 23 196 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00908 GO:0008830 dTDP-4-dehydrorhamnose 3,5-epimerase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.