Protein Family IF03580

Metagenome Isolate
253 Members
80 Samples
198 Scaffolds
326.61 Avg Length

🧬 Representative Sequence

ID
3300012803|Ga0160465_100404|Ga0160465_10040416
Length
370 aa
Sequence
VIWWQGVVGQGSDFLPGMGAYGESHNNERRSQIMMTAQYKITALQRAFKLMAYIVVCLFGILATGHLALAAEYPTRPIRIIVPFGAGGLTDIVARLVAERLSKDNAWNVIVENKTGAGGNIGAAEVARSKPDGYTLLMGSIGTNATNPFIYRRMTFDPKKDFAPITLAATGTLLLVVNPALPIHSTKELIDYARQHPGKLSYGSGGMGASQHLAGELLKSMAKIDIQHVPYKGLAPAIPDLLAGRIALTFDMATALPYVKSGKLRAIAVANPERSEALPDVPTIAESGVPGYAASAWYGFFAPAGTPDDIIQLLNKKITGILKLDDIGQRLLAMGAEPAMSTPQELAAYVAAESEKWGKVLKGLNLQLD*

📊 Sample Types

Isolate 20.9%
Metagenome 79.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.4%
Formicidae 21.4%
Culicidae 12.9%
Armadillidiidae 11.4%
Unclassified 8.6%
Elmidae 7.1%
Kalotermitidae 7.1%
Curculionidae 4.3%
Hydrophilidae 2.9%
Crambidae 1.4%
Alydidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 215
Eukaryota 0
Viruses 0
Unclassified 38

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
2 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
3 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
6 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
7 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
8 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
9 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
13 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 8100455565 Delftia sp. S67 Isolate Curculionidae
16 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
17 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
20 2864937364 Acidovorax soli S00198 Isolate Elmidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
23 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
24 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
28 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
31 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
32 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
33 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
34 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
39 8100449422 Delftia sp. S66 Isolate Curculionidae
40 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
41 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
42 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
45 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
46 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
47 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
48 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
49 2868169047 Comamonas aquatica S00077 Isolate Elmidae
50 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
51 8100461708 Delftia sp. S65 Isolate Curculionidae
52 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
53 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
56 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
57 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
58 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
59 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
60 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
61 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
62 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
63 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
64 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
65 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
66 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
67 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
68 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
71 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
72 2603880170 Burkholderiales A2 Isolate Unclassified
73 2603880172 Burkholderiales C Isolate Unclassified
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
76 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
77 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
78 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
79 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_024186 3300042618 Bacteria 12390
2 Ga0466734_041979 3300042623 Bacteria 1433
3 Ga0466734_046982 3300042623 Bacteria 1619
4 Ga0466730_011115 3300042625 Bacteria 159275
5 Ga0466730_013812 3300042625 Bacteria 185537
6 Ga0123355_10357597 3300009826 Unclassified 1927
7 Ga0160465_100404 3300012803 Bacteria 22953
8 Ga0160471_100075 3300012812 Bacteria 87706
9 Ga0466701_027517 3300042598 Unclassified 29394
10 Ga0466701_038054 3300042598 Unclassified 6359
11 CVPL010W_10001199 3300002931 Bacteria 37871
12 Ga0103261_1000871 3300007083 Bacteria 4665
13 Ga0102734_1007872 3300007129 Bacteria 3601
14 Ga0103264_1000368 3300007188 Bacteria 23778
15 Ga0103264_1001621 3300007188 Unclassified 15941
16 Ga0160470_100914 3300012813 Unclassified 8570
17 Ga0160456_100569 3300012820 Bacteria 11131
18 Ga0160469_100047 3300012824 Bacteria 208696
19 Ga0160469_100051 3300012824 Bacteria 203583
20 Ga0160441_100010 3300012825 Bacteria 490758
21 Ga0160444_100005 3300012841 Bacteria 646301
22 Ga0160460_105000 3300012845 Bacteria 1952
23 Ga0160447_100030 3300012849 Bacteria 210871
24 Ga0466657_315469 3300042582 Bacteria 2707
25 Ga0466730_038558 3300042625 Bacteria 566435
26 Ga0466730_071840 3300042625 Unclassified 44056
27 Ga0466724_43702 3300042649 Bacteria 16437
28 Ga0466724_58595 3300042649 Bacteria 137649
29 Ga0466724_62229 3300042649 Unclassified 15105
30 Ga0123355_10294139 3300009826 Bacteria 2224
31 Ga0123356_10143641 3300010049 Bacteria 2358
32 Ga0160465_103159 3300012803 Bacteria 3149
33 Ga0466701_028073 3300042598 Bacteria 1634
34 Ga0466701_074178 3300042598 Unclassified 3683
35 Ga0466701_085381 3300042598 Bacteria 4824
36 CVPL010W_10013871 3300002931 Bacteria 6031
37 Ga0103264_1000647 3300007188 Bacteria 21417
38 Ga0103268_1000680 3300007192 Unclassified 9791
39 Ga0160456_100059 3300012820 Bacteria 166063
40 Ga0160452_107127 3300012834 Bacteria 1502
41 Ga0160433_102573 3300012846 Bacteria 3792
42 Ga0466657_100047 3300042582 Bacteria 1104
43 Ga0466701_002704 3300042598 Unclassified 2383
44 Ga0466728_248439 3300042620 Bacteria 27319
45 Ga0466730_001347 3300042625 Unclassified 34704
46 Ga0466730_007701 3300042625 Bacteria 130976
47 Ga0123355_10378106 3300009826 Bacteria 1848
48 Ga0123356_10105981 3300010049 Unclassified 2705
49 Ga0160454_101313 3300012798 Bacteria 3844
50 Ga0160465_104838 3300012803 Bacteria 1927
51 Ga0160471_100895 3300012812 Unclassified 6793
52 Ga0160470_100056 3300012813 Bacteria 164821
53 Ga0466701_033099 3300042598 Bacteria 3426
54 Ga0466701_052508 3300042598 Bacteria 235417
55 Ga0466701_086007 3300042598 Bacteria 43193
56 Ga0103261_1001128 3300007083 Bacteria 4776
57 Ga0102734_1002837 3300007129 Unclassified 5771
58 Ga0102737_1009451 3300007142 Unclassified 1676
59 Ga0103264_1000910 3300007188 Bacteria 13319
60 Ga0160470_101092 3300012813 Bacteria 7345
61 Ga0160468_100212 3300012819 Bacteria 36616
62 Ga0160472_101359 3300012839 Bacteria 7427
63 Ga0160472_105195 3300012839 Bacteria 2131
64 Ga0160447_102658 3300012849 Bacteria 6123
65 Ga0160447_109745 3300012849 Bacteria 2170
66 Ga0160430_107019 3300012852 Bacteria 2318
67 Ga0466657_130726 3300042582 Bacteria 1207
68 Ga0466710_102500 3300042613 Bacteria 2555
69 Ga0466730_056495 3300042625 Bacteria 3140
70 Ga0466730_062339 3300042625 Bacteria 155913
71 Ga0466724_49390 3300042649 Unclassified 11771
72 Ga0466724_57906 3300042649 Bacteria 581904
73 Ga0466708_120368 3300042652 Bacteria 5495
74 Ga0123357_10104972 3300009784 Bacteria 3626
75 Ga0123356_10523946 3300010049 Bacteria 1344
76 Ga0123354_10001863 3300010882 Bacteria 26693
77 Ga0466701_027539 3300042598 Unclassified 35933
78 Ga0466701_041319 3300042598 Bacteria 27981
79 Ga0466701_044464 3300042598 Bacteria 300143
80 CVPL010W_10003849 3300002931 Bacteria 25974
81 Ga0102739_1000523 3300007095 Bacteria 7619
82 Ga0102740_1001457 3300007140 Unclassified 5999
83 Ga0102740_1001762 3300007140 Unclassified 5298
84 Ga0102737_1005218 3300007142 Bacteria 2621
85 Ga0103268_1000316 3300007192 Bacteria 15678
86 Ga0160470_100201 3300012813 Unclassified 51085
87 Ga0160468_101064 3300012819 Bacteria 7919
88 Ga0160456_101206 3300012820 Bacteria 6514
89 Ga0160456_104987 3300012820 Bacteria 1666
90 Ga0160469_100024 3300012824 Bacteria 306500
91 Ga0160469_100597 3300012824 Unclassified 14575
92 Ga0160459_100041 3300012831 Bacteria 228416
93 Ga0160455_100012 3300012837 Bacteria 588253
94 Ga0160472_100105 3300012839 Bacteria 135252
95 Ga0160472_101989 3300012839 Bacteria 5067
96 Ga0160472_102155 3300012839 Bacteria 4723
97 Ga0160444_100004 3300012841 Bacteria 649715
98 Ga0160460_103157 3300012845 Bacteria 3073
99 Ga0160447_101553 3300012849 Bacteria 8836
100 Ga0160447_107435 3300012849 Bacteria 2741
101 Ga0160435_1004412 3300012857 Bacteria 3257
102 Ga0466734_045708 3300042623 Bacteria 7449
103 Ga0160465_101576 3300012803 Bacteria 6360
104 Ga0160471_100478 3300012812 Unclassified 11139
105 Ga0160470_100046 3300012813 Bacteria 181385
106 Ga0466701_048605 3300042598 Bacteria 117003
107 Ga0466701_070542 3300042598 Bacteria 3847
108 CVPL005W_1000288 3300002934 Bacteria 21814
109 Ga0102736_1001317 3300007052 Bacteria 4392
110 Ga0103264_1002010 3300007188 Bacteria 9550
111 Ga0103267_1000538 3300007190 Bacteria 15461
112 Ga0160470_100771 3300012813 Bacteria 9950
113 Ga0160453_100062 3300012814 Bacteria 113502
114 Ga0160456_100072 3300012820 Unclassified 142162
115 Ga0160469_100041 3300012824 Bacteria 219309
116 Ga0160458_100741 3300012832 Unclassified 10182
117 Ga0160452_100005 3300012834 Bacteria 490758
118 Ga0160444_100179 3300012841 Bacteria 58581
119 Ga0160430_100090 3300012852 Bacteria 80044
120 Ga0160430_102590 3300012852 Bacteria 5611
121 Ga0160435_1002700 3300012857 Bacteria 4291
122 Ga0160457_1003595 3300012858 Unclassified 2670
123 Ga0160436_1007002 3300012861 Unclassified 2586
124 Ga0466657_035154 3300042582 Bacteria 1965
125 Ga0466657_343879 3300042582 Bacteria 1421
126 Ga0466715_412947 3300042616 Bacteria 4118
127 Ga0466730_055911 3300042625 Bacteria 12879
128 Ga0466724_42462 3300042649 Bacteria 351483
129 Ga0466708_252678 3300042652 Bacteria 7140
130 Ga0123354_10010762 3300010882 Bacteria 14114
131 Ga0160454_100393 3300012798 Bacteria 22527
132 Ga0160454_100647 3300012798 Bacteria 8060
133 Ga0160465_100027 3300012803 Bacteria 211818
134 Ga0160465_101529 3300012803 Bacteria 6547
135 Ga0160466_102126 3300012809 Bacteria 4249
136 Ga0466701_038088 3300042598 Bacteria 3681
137 Ga0466701_095768 3300042598 Bacteria 5052
138 Ga0466721_064898 3300042608 Unclassified 1111
139 JGI24705J35276_12236968 3300002504 Bacteria 9448
140 CVPL010W_10020046 3300002931 Bacteria 3921
141 Ga0102737_1008208 3300007142 Bacteria 1859
142 Ga0102737_1013738 3300007142 Unclassified 1309
143 Ga0160456_100281 3300012820 Bacteria 21658
144 Ga0160456_100410 3300012820 Bacteria 14568
145 Ga0160431_100088 3300012828 Bacteria 71491
146 Ga0160459_100088 3300012831 Bacteria 102895
147 Ga0160472_101238 3300012839 Bacteria 8149
148 Ga0160445_100008 3300012847 Unclassified 318878
149 Ga0466656_133707 3300042550 Bacteria 5185
150 Ga0466710_018990 3300042613 Bacteria 1948
151 Ga0466710_187492 3300042613 Bacteria 2841
152 Ga0466724_25034 3300042649 Bacteria 837337
153 Ga0466724_43634 3300042649 Bacteria 373148
154 Ga0123354_10203538 3300010882 Bacteria 2166
155 Ga0466701_041511 3300042598 Bacteria 5620
156 Ga0466701_098710 3300042598 Bacteria 149797
157 Ga0466701_102684 3300042598 Bacteria 104971
158 Ga0466713_054082 3300042602 Bacteria 13838
159 Ga0466719_259129 3300042606 Bacteria 6964
160 Ga0466721_026735 3300042608 Unclassified 1908
161 Ga0466721_217159 3300042608 Bacteria 1409
162 Ga0466721_301975 3300042608 Bacteria 2167
163 Ga0102736_1005200 3300007052 Bacteria 2932
164 Ga0103261_1001609 3300007083 Bacteria 3590
165 Ga0103260_1001335 3300007139 Bacteria 7208
166 Ga0102740_1000275 3300007140 Unclassified 14602
167 Ga0102740_1002225 3300007140 Unclassified 4534
168 Ga0160441_105609 3300012825 Bacteria 1839
169 Ga0160472_103057 3300012839 Bacteria 3474
170 Ga0160444_100159 3300012841 Bacteria 66741
171 Ga0160447_101429 3300012849 Bacteria 9294
172 Ga0160435_1004586 3300012857 Bacteria 3197
173 Ga0160436_1009896 3300012861 Unclassified 2092
174 Ga0466657_291758 3300042582 Bacteria 2161
175 Ga0466693_222223 3300042592 Bacteria 6633
176 Ga0466710_149673 3300042613 Bacteria 1591
177 Ga0466724_16999 3300042649 Bacteria 89252
178 Ga0466724_35850 3300042649 Bacteria 120573
179 Ga0123356_10405654 3300010049 Bacteria 1501
180 Ga0160442_104440 3300012806 Unclassified 1442
181 Ga0466697_000921 3300042611 Bacteria 4194
182 CVPL005W_1000646 3300002934 Bacteria 12491
183 Ga0068305_10235330 3300005083 Unclassified 2678
184 Ga0103263_101049 3300007042 Unclassified 3668
185 Ga0103266_1000008 3300007067 Bacteria 116820
186 Ga0103265_1005123 3300007068 Bacteria 2949
187 Ga0102734_1008311 3300007129 Bacteria 2363
188 Ga0102737_1000168 3300007142 Unclassified 21890
189 Ga0103264_1001186 3300007188 Bacteria 11518
190 Ga0103264_1018009 3300007188 Bacteria 6397
191 Ga0160440_100029 3300012815 Bacteria 231726
192 Ga0160469_100043 3300012824 Bacteria 213840
193 Ga0160469_100061 3300012824 Bacteria 182119
194 Ga0160472_103138 3300012839 Bacteria 3396
195 Ga0160430_101153 3300012852 Bacteria 10684
196 Ga0160435_1001928 3300012857 Unclassified 5106
197 Ga0466693_088416 3300042592 Bacteria 6567
198 Ga0466701_010334 3300042598 Bacteria 40691

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012839 Ga0160472_101238 Ga0160472_1012387 280
2 3300012820 Ga0160456_100059 Ga0160456_100059153 295
3 3300012846 Ga0160433_102573 Ga0160433_1025732 295
4 3300012803 Ga0160465_101529 Ga0160465_1015292 296
5 3300007192 Ga0103268_1000680 Ga0103268_100068011 298
6 3300007067 Ga0103266_1000008 Ga0103266_100000882 299
7 3300007190 Ga0103267_1000538 Ga0103267_10005389 299
8 3300007129 Ga0102734_1008311 Ga0102734_10083112 301
9 3300012820 Ga0160456_100281 Ga0160456_1002818 304
10 3300042598 Ga0466701_052508 Ga0466701_052508_14137_15105 305
11 3300002504 JGI24705J35276_12236968 JGI24705J35276_122369683 306
12 3300042598 Ga0466701_027539 Ga0466701_027539_26536_27540 308
13 3300042625 Ga0466730_011115 Ga0466730_011115_92901_93905 308
14 3300042598 Ga0466701_095768 Ga0466701_095768_1466_2458 310
15 iso_pr_bacteria 2873565274 2873568442 310
16 iso_pr_bacteria 2873571580 2873575367 310
17 3300042592 Ga0466693_088416 Ga0466693_088416_5349_6332 311
18 3300012839 Ga0160472_103138 Ga0160472_1031385 312
19 3300012839 Ga0160472_105195 Ga0160472_1051952 312
20 3300042608 Ga0466721_064898 Ga0466721_064898_58_996 312
21 3300042625 Ga0466730_062339 Ga0466730_062339_58539_59477 312
22 3300009826 Ga0123355_10378106 Ga0123355_103781062 313
23 3300012839 Ga0160472_100105 Ga0160472_100105102 313
24 3300012849 Ga0160447_100030 Ga0160447_100030126 313
25 3300042620 Ga0466728_248439 Ga0466728_248439_15164_16105 313
26 3300042598 Ga0466701_085381 Ga0466701_085381_3705_4673 314
27 3300042649 Ga0466724_16999 Ga0466724_16999_50495_51493 314
28 3300042649 Ga0466724_49390 Ga0466724_49390_490_1458 314
29 3300042649 Ga0466724_62229 Ga0466724_62229_1062_2057 314
30 3300010882 Ga0123354_10010762 Ga0123354_100107628 315
31 3300012819 Ga0160468_100212 Ga0160468_10021229 315
32 3300042611 Ga0466697_000921 Ga0466697_000921_3236_4183 315
33 3300012849 Ga0160447_100030 Ga0160447_10003051 316
34 3300042608 Ga0466721_026735 Ga0466721_026735_582_1532 316
35 3300042623 Ga0466734_045708 Ga0466734_045708_3429_4415 316
36 3300010049 Ga0123356_10523946 Ga0123356_105239461 317
37 3300012845 Ga0160460_105000 Ga0160460_1050002 317
38 3300042550 Ga0466656_133707 Ga0466656_133707_3213_4166 317
39 3300042582 Ga0466657_291758 Ga0466657_291758_978_1931 317
40 3300042582 Ga0466657_343879 Ga0466657_343879_334_1287 317
41 3300009784 Ga0123357_10104972 Ga0123357_101049724 318
42 3300042649 Ga0466724_43634 Ga0466724_43634_163419_164402 318
43 3300012824 Ga0160469_100024 Ga0160469_100024180 319
44 3300042613 Ga0466710_149673 Ga0466710_149673_299_1279 319
45 3300042652 Ga0466708_252678 Ga0466708_252678_4454_5452 319
46 iso_pr_bacteria 2873571580 2873574259 319
47 3300007052 Ga0102736_1005200 Ga0102736_10052003 320
48 3300007142 Ga0102737_1005218 Ga0102737_10052183 320
49 3300009826 Ga0123355_10294139 Ga0123355_102941392 320
50 3300012812 Ga0160471_100075 Ga0160471_10007517 320
51 3300012813 Ga0160470_101092 Ga0160470_1010924 320
52 3300042602 Ga0466713_054082 Ga0466713_054082_4088_5050 320
53 3300005083 Ga0068305_10235330 Ga0068305_102353304 321
54 3300012803 Ga0160465_104838 Ga0160465_1048382 321
55 3300012819 Ga0160468_101064 Ga0160468_1010646 321
56 3300042582 Ga0466657_100047 Ga0466657_100047_94_1059 321
57 3300007142 Ga0102737_1008208 Ga0102737_10082081 322
58 3300010049 Ga0123356_10143641 Ga0123356_101436412 322
59 3300042598 Ga0466701_010334 Ga0466701_010334_10968_11936 322
60 3300042598 Ga0466701_048605 Ga0466701_048605_61349_62317 322
61 3300042598 Ga0466701_052508 Ga0466701_052508_148535_149503 322
62 3300042598 Ga0466701_098710 Ga0466701_098710_42698_43666 322
63 3300042613 Ga0466710_187492 Ga0466710_187492_1593_2561 322
64 3300042625 Ga0466730_038558 Ga0466730_038558_453705_454673 322
65 3300042649 Ga0466724_25034 Ga0466724_25034_117994_118962 322
66 iso_pr_bacteria 2855798354 2855801260 322
67 iso_pr_bacteria 2855798354 2855801451 322
68 iso_pr_bacteria 2864826666 2864831186 322
69 iso_pr_bacteria 2864870719 2864871729 322
70 iso_pr_bacteria 2864960361 2864961374 322
71 iso_pr_bacteria 8100449422 8100455274 322
72 iso_pr_bacteria 8100455565 8100455989 322
73 iso_pr_bacteria 8100461708 8100467370 322
74 3300012820 Ga0160456_100410 Ga0160456_1004108 323
75 3300042613 Ga0466710_018990 Ga0466710_018990_844_1860 323
76 iso_pr_bacteria 2868169047 2868169358 323
77 3300012812 Ga0160471_100895 Ga0160471_1008954 324
78 3300012820 Ga0160456_104987 Ga0160456_1049871 324
79 3300012831 Ga0160459_100041 Ga0160459_100041102 324
80 3300012834 Ga0160452_100005 Ga0160452_100005342 324
81 3300012837 Ga0160455_100012 Ga0160455_100012406 324
82 3300012839 Ga0160472_102155 Ga0160472_1021552 324
83 3300012841 Ga0160444_100005 Ga0160444_100005319 324
84 3300012857 Ga0160435_1004412 Ga0160435_10044123 324
85 iso_pr_bacteria 2864870719 2864874189 324
86 iso_pr_bacteria 2864937364 2864942464 324
87 iso_pr_bacteria 2864960361 2864963798 324
88 3300012806 Ga0160442_104440 Ga0160442_1044402 325
89 3300012813 Ga0160470_100046 Ga0160470_10004633 325
90 3300012813 Ga0160470_100056 Ga0160470_100056109 325
91 3300012841 Ga0160444_100179 Ga0160444_10017919 325
92 3300012849 Ga0160447_101429 Ga0160447_1014294 325
93 3300012849 Ga0160447_101553 Ga0160447_1015532 325
94 3300042625 Ga0466730_056495 Ga0466730_056495_1376_2353 325
95 iso_pr_bacteria 2687453742 2689988574 325
96 iso_pr_bacteria 2687453753 2690039064 325
97 iso_pr_bacteria 2864826666 2864831262 325
98 iso_pr_bacteria 2864937364 2864938649 325
99 iso_pr_bacteria 2873565274 2873566244 325
100 3300007083 Ga0103261_1000871 Ga0103261_10008715 326
101 3300007140 Ga0102740_1001457 Ga0102740_10014575 326
102 3300007142 Ga0102737_1000168 Ga0102737_100016812 326
103 3300007188 Ga0103264_1000910 Ga0103264_10009108 326
104 3300007188 Ga0103264_1001621 Ga0103264_100162113 326
105 3300012798 Ga0160454_100647 Ga0160454_10064710 326
106 3300012803 Ga0160465_100027 Ga0160465_10002757 326
107 3300012815 Ga0160440_100029 Ga0160440_10002978 326
108 3300012820 Ga0160456_100072 Ga0160456_10007243 326
109 3300012824 Ga0160469_100061 Ga0160469_100061119 326
110 3300012825 Ga0160441_100010 Ga0160441_100010113 326
111 3300012849 Ga0160447_109745 Ga0160447_1097452 326
112 3300012852 Ga0160430_100090 Ga0160430_10009025 326
113 3300012858 Ga0160457_1003595 Ga0160457_10035952 326
114 3300042582 Ga0466657_130726 Ga0466657_130726_130_1110 326
115 3300042582 Ga0466657_315469 Ga0466657_315469_468_1448 326
116 3300042598 Ga0466701_102684 Ga0466701_102684_71225_72205 326
117 3300042613 Ga0466710_102500 Ga0466710_102500_1517_2497 326
118 3300042623 Ga0466734_041979 Ga0466734_041979_158_1138 326
119 iso_pr_bacteria 2855798354 2855803068 326
120 iso_pr_bacteria 8100449422 8100450208 326
121 iso_pr_bacteria 8100455565 8100456578 326
122 iso_pr_bacteria 8100461708 8100461883 326
123 3300007192 Ga0103268_1000316 Ga0103268_10003168 327
124 3300010882 Ga0123354_10001863 Ga0123354_1000186322 327
125 3300010882 Ga0123354_10203538 Ga0123354_102035382 327
126 3300012798 Ga0160454_100393 Ga0160454_1003937 327
127 3300012852 Ga0160430_101153 Ga0160430_1011535 327
128 3300012857 Ga0160435_1004586 Ga0160435_10045863 327
129 3300042592 Ga0466693_222223 Ga0466693_222223_4932_5915 327
130 3300042608 Ga0466721_217159 Ga0466721_217159_392_1375 327
131 3300042625 Ga0466730_013812 Ga0466730_013812_126250_127233 327
132 3300042649 Ga0466724_42462 Ga0466724_42462_318453_319436 327
133 iso_pr_bacteria 2855798354 2855804363 327
134 iso_pr_bacteria 2864937364 2864939406 327
135 3300007042 Ga0103263_101049 Ga0103263_1010492 328
136 3300007068 Ga0103265_1005123 Ga0103265_10051235 328
137 3300007083 Ga0103261_1001128 Ga0103261_10011284 328
138 3300010049 Ga0123356_10405654 Ga0123356_104056542 328
139 3300012812 Ga0160471_100478 Ga0160471_1004786 328
140 3300012834 Ga0160452_107127 Ga0160452_1071272 328
141 3300012839 Ga0160472_101989 Ga0160472_1019894 328
142 3300012841 Ga0160444_100159 Ga0160444_10015942 328
143 3300012845 Ga0160460_103157 Ga0160460_1031573 328
144 3300012852 Ga0160430_102590 Ga0160430_1025904 328
145 3300012857 Ga0160435_1001928 Ga0160435_10019283 328
146 3300042598 Ga0466701_028073 Ga0466701_028073_296_1282 328
147 3300042598 Ga0466701_033099 Ga0466701_033099_1003_1989 328
148 3300042652 Ga0466708_120368 Ga0466708_120368_2802_3815 328
149 iso_pr_bacteria 2864870719 2864872385 328
150 iso_pr_bacteria 2864960361 2864962033 328
151 iso_pr_bacteria 2873565274 2873566104 328
152 iso_pr_bacteria 2873565274 2873566247 328
153 iso_pr_bacteria 2873571580 2873575218 328
154 3300002931 CVPL010W_10003849 CVPL010W_1000384915 329
155 3300012798 Ga0160454_101313 Ga0160454_1013132 329
156 3300012820 Ga0160456_100569 Ga0160456_1005699 329
157 3300012824 Ga0160469_100041 Ga0160469_10004110 329
158 3300012825 Ga0160441_105609 Ga0160441_1056092 329
159 3300012852 Ga0160430_107019 Ga0160430_1070192 329
160 3300042582 Ga0466657_035154 Ga0466657_035154_519_1508 329
161 3300042598 Ga0466701_041319 Ga0466701_041319_5489_6478 329
162 iso_pr_bacteria 2603880172 2606033474 329
163 iso_pr_bacteria 2687453753 2690038325 329
164 iso_pr_bacteria 8100449422 8100451896 329
165 iso_pr_bacteria 8100455565 8100459229 329
166 iso_pr_bacteria 8100461708 8100465257 329
167 3300002931 CVPL010W_10013871 CVPL010W_100138714 330
168 3300002931 CVPL010W_10020046 CVPL010W_100200463 330
169 3300007129 Ga0102734_1007872 Ga0102734_10078722 330
170 3300007139 Ga0103260_1001335 Ga0103260_10013353 330
171 3300007140 Ga0102740_1001762 Ga0102740_10017624 330
172 3300007188 Ga0103264_1002010 Ga0103264_10020108 330
173 3300007188 Ga0103264_1018009 Ga0103264_10180098 330
174 3300012813 Ga0160470_100914 Ga0160470_1009149 330
175 3300012828 Ga0160431_100088 Ga0160431_1000888 330
176 3300042649 Ga0466724_57906 Ga0466724_57906_181003_181995 330
177 iso_pr_bacteria 2687453742 2689989349 330
178 iso_pr_bacteria 2687453753 2690037020 330
179 iso_pr_bacteria 2864826666 2864826880 330
180 iso_pr_bacteria 2873565274 2873570613 330
181 iso_pr_bacteria 8024031916 8024033438 330
182 3300002934 CVPL005W_1000288 CVPL005W_10002887 331
183 3300007052 Ga0102736_1001317 Ga0102736_10013172 331
184 3300007095 Ga0102739_1000523 Ga0102739_10005233 331
185 3300007129 Ga0102734_1002837 Ga0102734_10028372 331
186 3300007142 Ga0102737_1013738 Ga0102737_10137382 331
187 3300007188 Ga0103264_1000368 Ga0103264_100036816 331
188 3300007188 Ga0103264_1000647 Ga0103264_100064711 331
189 3300012824 Ga0160469_100043 Ga0160469_10004366 331
190 3300012831 Ga0160459_100088 Ga0160459_1000883 331
191 3300042598 Ga0466701_044464 Ga0466701_044464_276519_277514 331
192 iso_pr_bacteria 2873571580 2873572204 331
193 3300042598 Ga0466701_041511 Ga0466701_041511_354_1352 332
194 3300042598 Ga0466701_074178 Ga0466701_074178_1807_2805 332
195 3300042625 Ga0466730_055911 Ga0466730_055911_1188_2186 332
196 3300042649 Ga0466724_43702 Ga0466724_43702_2564_3562 332
197 3300042649 Ga0466724_58595 Ga0466724_58595_91536_92534 332
198 iso_pr_bacteria 8024031916 8024035331 332
199 3300007140 Ga0102740_1000275 Ga0102740_10002754 333
200 3300012803 Ga0160465_101576 Ga0160465_1015766 333
201 3300012824 Ga0160469_100047 Ga0160469_100047127 333
202 3300012861 Ga0160436_1007002 Ga0160436_10070023 333
203 iso_pr_bacteria 8024031916 8024034694 333
204 3300007083 Ga0103261_1001609 Ga0103261_10016092 334
205 3300012809 Ga0160466_102126 Ga0160466_1021265 334
206 3300012824 Ga0160469_100597 Ga0160469_1005977 334
207 3300012847 Ga0160445_100008 Ga0160445_100008123 334
208 3300042598 Ga0466701_027517 Ga0466701_027517_5360_6364 334
209 3300042618 Ga0466723_024186 Ga0466723_024186_6523_7527 334
210 3300042625 Ga0466730_007701 Ga0466730_007701_56392_57396 334
211 iso_pr_bacteria 2603880170 2606028416 334
212 iso_pr_bacteria 2864937364 2864940111 334
213 iso_pr_bacteria 2873565274 2873571106 334
214 iso_pr_bacteria 8100449422 8100451666 334
215 iso_pr_bacteria 8100455565 8100460700 334
216 iso_pr_bacteria 8100461708 8100464081 334
217 3300002931 CVPL010W_10001199 CVPL010W_1000119912 335
218 3300007140 Ga0102740_1002225 Ga0102740_10022252 335
219 3300007142 Ga0102737_1009451 Ga0102737_10094512 335
220 3300012839 Ga0160472_103057 Ga0160472_1030573 335
221 3300012857 Ga0160435_1002700 Ga0160435_10027002 336
222 3300012820 Ga0160456_101206 Ga0160456_1012062 337
223 3300012824 Ga0160469_100051 Ga0160469_100051152 337
224 3300012841 Ga0160444_100004 Ga0160444_100004324 337
225 iso_pr_bacteria 2855798354 2855800122 337
226 3300012813 Ga0160470_100771 Ga0160470_10077112 338
227 3300042606 Ga0466719_259129 Ga0466719_259129_4050_5066 338
228 3300042623 Ga0466734_046982 Ga0466734_046982_145_1161 338
229 iso_pr_bacteria 2855798354 2855798962 338
230 3300042598 Ga0466701_070542 Ga0466701_070542_1459_2478 339
231 3300002934 CVPL005W_1000646 CVPL005W_100064611 340
232 3300012813 Ga0160470_100201 Ga0160470_10020152 340
233 3300012839 Ga0160472_101359 Ga0160472_1013596 340
234 3300012849 Ga0160447_102658 Ga0160447_1026586 340
235 3300042616 Ga0466715_412947 Ga0466715_412947_394_1419 341
236 3300007188 Ga0103264_1001186 Ga0103264_10011866 343
237 3300042598 Ga0466701_002704 Ga0466701_002704_228_1262 344
238 3300042598 Ga0466701_038054 Ga0466701_038054_555_1589 344
239 3300042598 Ga0466701_038088 Ga0466701_038088_2348_3382 344
240 3300042625 Ga0466730_001347 Ga0466730_001347_3947_4981 344
241 3300042649 Ga0466724_35850 Ga0466724_35850_37566_38600 344
242 3300012814 Ga0160453_100062 Ga0160453_10006232 345
243 3300012832 Ga0160458_100741 Ga0160458_1007413 346
244 3300012849 Ga0160447_107435 Ga0160447_1074353 346
245 3300012861 Ga0160436_1009896 Ga0160436_10098962 346
246 3300042598 Ga0466701_086007 Ga0466701_086007_9936_10985 349
247 3300042625 Ga0466730_071840 Ga0466730_071840_10828_11877 349
248 3300009826 Ga0123355_10357597 Ga0123355_103575972 354
249 3300010049 Ga0123356_10105981 Ga0123356_101059812 354
250 3300042608 Ga0466721_301975 Ga0466721_301975_50_1141 354
251 3300012803 Ga0160465_103159 Ga0160465_1031592 360
252 iso_pr_bacteria 2864937364 2864940790 368
253 3300012803 Ga0160465_100404 Ga0160465_10040416 370

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03401 TctC Tripartite tricarboxylate transporter family receptor 93 366 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.