Protein Family IF03557
Metagenome
Isolate
146
Members
55
Samples
144
Scaffolds
142.29
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10590155|Ga0123354_105901551
- Length
- 158 aa
- Sequence
- MKDKRSGGASGGSGELRAGGGLRAEKEFDIRFNEVDSMNIVWHGSYVLYFEDAREAFGKKYGLGYLDIFGNGYYAPLVDLRFNFKKPLVYGQKARIEIVYRNTEAAKIVFDYEIYDSADNSLIATGYSVQVFLDKQYRLVWANPDFYERWKRNNGLI*
Sample Types
Isolate
1.4%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.9%
Kalotermitidae
23.6%
Unclassified
9.1%
Termopsidae
7.3%
Rhinotermitidae
3.6%
Passalidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_053995 | 3300042656 | Bacteria | 1578 |
| 2 | Ga0123356_10019384 | 3300010049 | Bacteria | 6448 |
| 3 | Ga0123353_10009889 | 3300010167 | Bacteria | 13227 |
| 4 | Ga0123354_10000685 | 3300010882 | Bacteria | 36047 |
| 5 | Ga0466735_089691 | 3300042624 | Bacteria | 2625 |
| 6 | Ga0466702_157344 | 3300042635 | Bacteria | 1322 |
| 7 | Ga0466726_374445 | 3300042619 | Unclassified | 5140 |
| 8 | Ga0466728_227747 | 3300042620 | Bacteria | 3521 |
| 9 | Ga0466728_281160 | 3300042620 | Bacteria | 13069 |
| 10 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 11 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 12 | Ga0466692_145515 | 3300042591 | Bacteria | 5774 |
| 13 | Ga0466691_191216 | 3300042593 | Bacteria | 6785 |
| 14 | Ga0466699_235204 | 3300042597 | Bacteria | 1135 |
| 15 | Ga0466701_075789 | 3300042598 | Bacteria | 4653 |
| 16 | Ga0466707_034592 | 3300042601 | Bacteria | 1133 |
| 17 | IMNBL1DRAFT_c0004635 | 3300000062 | Bacteria | 8172 |
| 18 | JGI24705J35276_12119401 | 3300002504 | Bacteria | 1068 |
| 19 | Ga0466697_169798 | 3300042611 | Bacteria | 2187 |
| 20 | Ga0466733_042701 | 3300042659 | Bacteria | 7371 |
| 21 | Ga0123356_10618881 | 3300010049 | Bacteria | 1248 |
| 22 | Ga0123353_10753692 | 3300010167 | Bacteria | 1354 |
| 23 | Ga0123354_10327136 | 3300010882 | Bacteria | 1404 |
| 24 | Ga0466735_056828 | 3300042624 | Bacteria | 5184 |
| 25 | Ga0466735_091012 | 3300042624 | Bacteria | 1211 |
| 26 | Ga0466704_374052 | 3300042643 | Bacteria | 4981 |
| 27 | Ga0466727_067438 | 3300042655 | Bacteria | 1010 |
| 28 | Ga0466727_261762 | 3300042655 | Bacteria | 29267 |
| 29 | Ga0466723_233898 | 3300042618 | Bacteria | 28559 |
| 30 | Ga0466726_280534 | 3300042619 | Bacteria | 3838 |
| 31 | Ga0466706_100787 | 3300042599 | Bacteria | 1560 |
| 32 | Ga0466700_193309 | 3300042600 | Bacteria | 37158 |
| 33 | Ga0466707_064288 | 3300042601 | Bacteria | 1584 |
| 34 | Ga0466717_101879 | 3300042604 | Bacteria | 1396 |
| 35 | JGI24702J35022_10022104 | 3300002462 | Bacteria | 3446 |
| 36 | Ga0068302_10030740 | 3300005071 | Bacteria | 1900 |
| 37 | Ga0123356_10397449 | 3300010049 | Bacteria | 1515 |
| 38 | Ga0466735_053315 | 3300042624 | Bacteria | 11454 |
| 39 | Ga0466735_136927 | 3300042624 | Bacteria | 7758 |
| 40 | Ga0466727_280437 | 3300042655 | Bacteria | 2492 |
| 41 | Ga0466711_123981 | 3300042615 | Bacteria | 4210 |
| 42 | Ga0466711_338621 | 3300042615 | Bacteria | 11912 |
| 43 | Ga0466718_093769 | 3300042617 | Bacteria | 2479 |
| 44 | Ga0466701_005505 | 3300042598 | Bacteria | 1608 |
| 45 | Ga0466713_042832 | 3300042602 | Bacteria | 25448 |
| 46 | Ga0466721_391119 | 3300042608 | Bacteria | 1025 |
| 47 | 2227441892 | 2225789004 | Bacteria | 26182 |
| 48 | JGI24702J35022_10016142 | 3300002462 | Bacteria | 4100 |
| 49 | JGI24705J35276_11410361 | 3300002504 | Bacteria | 530 |
| 50 | Ga0123356_10053042 | 3300010049 | Bacteria | 3774 |
| 51 | Ga0123354_10079619 | 3300010882 | Bacteria | 4647 |
| 52 | Ga0123354_10590155 | 3300010882 | Bacteria | 819 |
| 53 | Ga0466735_142433 | 3300042624 | Bacteria | 2526 |
| 54 | Ga0466708_085174 | 3300042652 | Bacteria | 23155 |
| 55 | Ga0466715_440572 | 3300042616 | Bacteria | 3452 |
| 56 | Ga0466728_046855 | 3300042620 | Bacteria | 21751 |
| 57 | Ga0466706_280280 | 3300042599 | Bacteria | 34158 |
| 58 | Ga0466716_202600 | 3300042605 | Bacteria | 25648 |
| 59 | IMNBL1DRAFT_c0019299 | 3300000062 | Bacteria | 2798 |
| 60 | JGI24702J35022_10001105 | 3300002462 | Bacteria | 16782 |
| 61 | JGI24702J35022_10005003 | 3300002462 | Bacteria | 7819 |
| 62 | JGI24696J40584_12961309 | 3300002834 | Bacteria | 13431 |
| 63 | Ga0068305_10089653 | 3300005083 | Bacteria | 5669 |
| 64 | Ga0123357_10520517 | 3300009784 | Bacteria | 972 |
| 65 | Ga0123356_12357115 | 3300010049 | Bacteria | 666 |
| 66 | Ga0123353_10271464 | 3300010167 | Bacteria | 2613 |
| 67 | Ga0123354_10328358 | 3300010882 | Bacteria | 1399 |
| 68 | Ga0466704_334106 | 3300042643 | Bacteria | 7902 |
| 69 | Ga0466704_415920 | 3300042643 | Unclassified | 2618 |
| 70 | Ga0466725_409493 | 3300042654 | Bacteria | 2026 |
| 71 | Ga0466710_352262 | 3300042613 | Bacteria | 1634 |
| 72 | Ga0466694_165580 | 3300042594 | Bacteria | 2451 |
| 73 | Ga0466699_440110 | 3300042597 | Bacteria | 2786 |
| 74 | Ga0466707_328919 | 3300042601 | Bacteria | 1140 |
| 75 | Ga0466716_190255 | 3300042605 | Bacteria | 1075 |
| 76 | Ga0466722_150720 | 3300042609 | Bacteria | 8542 |
| 77 | Ga0466722_265049 | 3300042609 | Bacteria | 14900 |
| 78 | IMNBL1DRAFT_c0002369 | 3300000062 | Bacteria | 13182 |
| 79 | JGI24702J35022_10000718 | 3300002462 | Bacteria | 20323 |
| 80 | JGI24702J35022_10107675 | 3300002462 | Bacteria | 1531 |
| 81 | Ga0068302_10584235 | 3300005071 | Unclassified | 1160 |
| 82 | Ga0123357_10097723 | 3300009784 | Bacteria | 3798 |
| 83 | Ga0123356_10101738 | 3300010049 | Bacteria | 2758 |
| 84 | Ga0123354_10014306 | 3300010882 | Bacteria | 12354 |
| 85 | Ga0466702_119576 | 3300042635 | Bacteria | 1737 |
| 86 | Ga0466704_156837 | 3300042643 | Bacteria | 12573 |
| 87 | Ga0466690_051493 | 3300042590 | Bacteria | 11140 |
| 88 | Ga0466693_013360 | 3300042592 | Bacteria | 1776 |
| 89 | Ga0466694_322645 | 3300042594 | Unclassified | 1715 |
| 90 | Ga0466695_288774 | 3300042595 | Bacteria | 1560 |
| 91 | Ga0466696_024005 | 3300042596 | Bacteria | 8939 |
| 92 | Ga0466699_013559 | 3300042597 | Bacteria | 1712 |
| 93 | Ga0466706_196261 | 3300042599 | Bacteria | 6844 |
| 94 | Ga0466717_051046 | 3300042604 | Bacteria | 1435 |
| 95 | Ga0466716_030847 | 3300042605 | Bacteria | 18551 |
| 96 | Ga0466719_529635 | 3300042606 | Bacteria | 2323 |
| 97 | Ga0466722_059383 | 3300042609 | Bacteria | 11770 |
| 98 | Ga0466698_100690 | 3300042610 | Bacteria | 1200 |
| 99 | IMNBL1DRAFT_c0010407 | 3300000062 | Bacteria | 4457 |
| 100 | JGI24702J35022_10082709 | 3300002462 | Bacteria | 1740 |
| 101 | JGI24702J35022_10228680 | 3300002462 | Bacteria | 1075 |
| 102 | Ga0068305_10687648 | 3300005083 | Bacteria | 1047 |
| 103 | Ga0466697_129513 | 3300042611 | Bacteria | 15313 |
| 104 | Ga0466697_226844 | 3300042611 | Bacteria | 1266 |
| 105 | Ga0466705_033491 | 3300042612 | Bacteria | 17745 |
| 106 | Ga0123357_10138060 | 3300009784 | Bacteria | 3007 |
| 107 | Ga0123356_10195620 | 3300010049 | Bacteria | 2057 |
| 108 | Ga0123356_13641367 | 3300010049 | Bacteria | 533 |
| 109 | Ga0123353_10004595 | 3300010167 | Bacteria | 17820 |
| 110 | Ga0123353_10747242 | 3300010167 | Bacteria | 1362 |
| 111 | Ga0123353_10778229 | 3300010167 | Bacteria | 1326 |
| 112 | Ga0123354_10200612 | 3300010882 | Bacteria | 2195 |
| 113 | Ga0466703_007524 | 3300042636 | Bacteria | 6716 |
| 114 | Ga0466727_136604 | 3300042655 | Bacteria | 8202 |
| 115 | Ga0466711_158516 | 3300042615 | Bacteria | 6744 |
| 116 | Ga0466656_257958 | 3300042550 | Bacteria | 1023 |
| 117 | Ga0466693_060347 | 3300042592 | Bacteria | 3209 |
| 118 | Ga0466693_446453 | 3300042592 | Bacteria | 1069 |
| 119 | Ga0466706_190648 | 3300042599 | Bacteria | 33307 |
| 120 | Ga0466707_168200 | 3300042601 | Unclassified | 3344 |
| 121 | JGI24705J35276_12157382 | 3300002504 | Bacteria | 1214 |
| 122 | Ga0068305_10010856 | 3300005083 | Bacteria | 14545 |
| 123 | Ga0123357_10063176 | 3300009784 | Bacteria | 4952 |
| 124 | Ga0123353_11472803 | 3300010167 | Bacteria | 869 |
| 125 | Ga0123354_10266036 | 3300010882 | Bacteria | 1699 |
| 126 | Ga0466703_173935 | 3300042636 | Bacteria | 16868 |
| 127 | Ga0466724_54555 | 3300042649 | Bacteria | 4273 |
| 128 | Ga0466712_246470 | 3300042614 | Bacteria | 1688 |
| 129 | Ga0466711_069779 | 3300042615 | Bacteria | 6729 |
| 130 | Ga0466711_075016 | 3300042615 | Bacteria | 12505 |
| 131 | Ga0466711_173423 | 3300042615 | Bacteria | 4378 |
| 132 | Ga0466715_443592 | 3300042616 | Bacteria | 6540 |
| 133 | Ga0466726_436128 | 3300042619 | Bacteria | 3851 |
| 134 | Ga0415639_092553 | 3300038395 | Bacteria | 1416 |
| 135 | Ga0466693_153095 | 3300042592 | Bacteria | 2192 |
| 136 | Ga0466693_295341 | 3300042592 | Bacteria | 1255 |
| 137 | Ga0466693_413922 | 3300042592 | Bacteria | 3633 |
| 138 | Ga0466691_120439 | 3300042593 | Bacteria | 3213 |
| 139 | Ga0466701_061419 | 3300042598 | Bacteria | 1915 |
| 140 | Ga0466717_062985 | 3300042604 | Bacteria | 3786 |
| 141 | Ga0466719_275216 | 3300042606 | Bacteria | 5564 |
| 142 | Ga0466722_021911 | 3300042609 | Bacteria | 53346 |
| 143 | JGI24695J34938_10186972 | 3300002450 | Bacteria | 859 |
| 144 | JGI24696J40584_12932407 | 3300002834 | Bacteria | 1501 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.