Protein Family IF03543
Metagenome
Isolate
117
Members
44
Samples
116
Scaffolds
115.15
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10289886|Ga0123354_102898862
- Length
- 136 aa
- Sequence
- VDYFFLGDPELVTAFRFVGISGFPVLSAADARDAFRRMTEGYDGTAAAVLPVAMANAGASAIAGEKTMGGAFAGAEFCRVLVMTEEVADWLGDSLIEWQLSNRYPLVVEVPGLMGRLPGRKTLVDSIREAIGIHV*
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Kalotermitidae
32.6%
Rhinotermitidae
9.3%
Unclassified
7.0%
Termopsidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_301831 | 3300042614 | Bacteria | 13171 |
| 2 | Ga0466711_225682 | 3300042615 | Bacteria | 21378 |
| 3 | Ga0466726_428381 | 3300042619 | Bacteria | 1404 |
| 4 | Ga0466709_233804 | 3300042648 | Bacteria | 3232 |
| 5 | Ga0466708_117267 | 3300042652 | Bacteria | 1400 |
| 6 | Ga0466727_309398 | 3300042655 | Unclassified | 2564 |
| 7 | Ga0123357_10137028 | 3300009784 | Bacteria | 3023 |
| 8 | Ga0123356_10194502 | 3300010049 | Bacteria | 2062 |
| 9 | Ga0466690_009307 | 3300042590 | Bacteria | 18597 |
| 10 | Ga0466692_188500 | 3300042591 | Bacteria | 54661 |
| 11 | Ga0466699_051184 | 3300042597 | Bacteria | 2065 |
| 12 | Ga0466706_018647 | 3300042599 | Bacteria | 6797 |
| 13 | Ga0466706_289021 | 3300042599 | Bacteria | 1602 |
| 14 | Ga0466719_047103 | 3300042606 | Bacteria | 1277 |
| 15 | Ga0466722_199067 | 3300042609 | Bacteria | 4535 |
| 16 | Ga0466728_448414 | 3300042620 | Bacteria | 2053 |
| 17 | Ga0466703_047869 | 3300042636 | Bacteria | 58815 |
| 18 | Ga0466708_080262 | 3300042652 | Bacteria | 6924 |
| 19 | Ga0123356_10259187 | 3300010049 | Bacteria | 1822 |
| 20 | Ga0123353_10486539 | 3300010167 | Bacteria | 1803 |
| 21 | Ga0123353_10569638 | 3300010167 | Bacteria | 1628 |
| 22 | Ga0264413_113507 | 3300024493 | Unclassified | 1755 |
| 23 | Ga0466694_268049 | 3300042594 | Bacteria | 1056 |
| 24 | Ga0466694_352694 | 3300042594 | Bacteria | 1614 |
| 25 | Ga0466696_017564 | 3300042596 | Bacteria | 33026 |
| 26 | Ga0466699_080147 | 3300042597 | Bacteria | 1197 |
| 27 | Ga0466716_360111 | 3300042605 | Bacteria | 1198 |
| 28 | Ga0466715_224666 | 3300042616 | Bacteria | 8442 |
| 29 | Ga0466723_058149 | 3300042618 | Bacteria | 34327 |
| 30 | Ga0466723_232250 | 3300042618 | Bacteria | 17224 |
| 31 | Ga0466727_061245 | 3300042655 | Bacteria | 2438 |
| 32 | Ga0123356_13064514 | 3300010049 | Bacteria | 583 |
| 33 | Ga0123353_10041766 | 3300010167 | Bacteria | 7249 |
| 34 | Ga0123354_10289886 | 3300010882 | Bacteria | 1571 |
| 35 | Ga0123354_10318110 | 3300010882 | Unclassified | 1441 |
| 36 | Ga0466690_203713 | 3300042590 | Bacteria | 7320 |
| 37 | Ga0466692_007920 | 3300042591 | Bacteria | 3718 |
| 38 | Ga0466692_055496 | 3300042591 | Bacteria | 11779 |
| 39 | Ga0466695_386991 | 3300042595 | Bacteria | 2886 |
| 40 | Ga0466707_001170 | 3300042601 | Bacteria | 2302 |
| 41 | JGI24702J35022_10053871 | 3300002462 | Bacteria | 2146 |
| 42 | Ga0466711_019948 | 3300042615 | Bacteria | 1641 |
| 43 | Ga0466723_075462 | 3300042618 | Bacteria | 18487 |
| 44 | Ga0466704_133824 | 3300042643 | Bacteria | 15469 |
| 45 | Ga0123357_10012810 | 3300009784 | Bacteria | 10831 |
| 46 | Ga0123357_10468566 | 3300009784 | Bacteria | 1076 |
| 47 | Ga0123353_10190440 | 3300010167 | Bacteria | 3238 |
| 48 | Ga0466692_075907 | 3300042591 | Bacteria | 15742 |
| 49 | Ga0466694_271147 | 3300042594 | Bacteria | 2207 |
| 50 | Ga0466696_207346 | 3300042596 | Bacteria | 25158 |
| 51 | Ga0466707_061290 | 3300042601 | Bacteria | 1023 |
| 52 | Ga0466722_140791 | 3300042609 | Bacteria | 30365 |
| 53 | JGI24705J35276_12150850 | 3300002504 | Bacteria | 1183 |
| 54 | Ga0466711_287450 | 3300042615 | Bacteria | 1257 |
| 55 | Ga0466731_239174 | 3300042622 | Bacteria | 4536 |
| 56 | Ga0466703_181719 | 3300042636 | Bacteria | 13950 |
| 57 | Ga0466704_548688 | 3300042643 | Bacteria | 41627 |
| 58 | Ga0466727_014068 | 3300042655 | Bacteria | 1637 |
| 59 | Ga0123357_10468633 | 3300009784 | Bacteria | 1076 |
| 60 | Ga0123353_11477709 | 3300010167 | Bacteria | 867 |
| 61 | Ga0123353_11645912 | 3300010167 | Bacteria | 807 |
| 62 | Ga0123354_10326654 | 3300010882 | Unclassified | 1406 |
| 63 | Ga0466694_072990 | 3300042594 | Bacteria | 3323 |
| 64 | Ga0466694_185248 | 3300042594 | Bacteria | 1609 |
| 65 | Ga0466699_442807 | 3300042597 | Bacteria | 1451 |
| 66 | Ga0466706_259848 | 3300042599 | Bacteria | 1763 |
| 67 | Ga0466717_245603 | 3300042604 | Bacteria | 1136 |
| 68 | Ga0466716_177762 | 3300042605 | Bacteria | 12591 |
| 69 | Ga0466719_062853 | 3300042606 | Bacteria | 19370 |
| 70 | Nasutiter_Contig34270 | 2030936001 | Bacteria | 716 |
| 71 | JGI24702J35022_10003922 | 3300002462 | Bacteria | 8935 |
| 72 | Ga0466705_101951 | 3300042612 | Bacteria | 11451 |
| 73 | Ga0466705_445603 | 3300042612 | Bacteria | 24455 |
| 74 | Ga0466715_115149 | 3300042616 | Bacteria | 6114 |
| 75 | Ga0466715_549812 | 3300042616 | Bacteria | 4244 |
| 76 | Ga0466729_201555 | 3300042621 | Bacteria | 1138 |
| 77 | Ga0466704_225547 | 3300042643 | Bacteria | 39919 |
| 78 | Ga0466727_004136 | 3300042655 | Bacteria | 2090 |
| 79 | Ga0264413_113462 | 3300024493 | Bacteria | 2024 |
| 80 | Ga0456237_0004269 | 3300041968 | Bacteria | 2301 |
| 81 | Ga0466693_239088 | 3300042592 | Bacteria | 1149 |
| 82 | Ga0466713_057497 | 3300042602 | Bacteria | 1467 |
| 83 | Ga0466722_147288 | 3300042609 | Bacteria | 12650 |
| 84 | Nasutiter_Contig00976 | 2030936001 | Bacteria | 2085 |
| 85 | AustNasuHG_c1003862 | 3300000089 | Bacteria | 5397 |
| 86 | Ga0466705_060803 | 3300042612 | Bacteria | 10244 |
| 87 | Ga0466723_100064 | 3300042618 | Bacteria | 25786 |
| 88 | Ga0466726_139804 | 3300042619 | Bacteria | 1923 |
| 89 | Ga0466726_259931 | 3300042619 | Bacteria | 15283 |
| 90 | Ga0466703_111746 | 3300042636 | Bacteria | 36067 |
| 91 | Ga0123356_10907902 | 3300010049 | Unclassified | 1052 |
| 92 | Ga0123353_10235361 | 3300010167 | Bacteria | 2851 |
| 93 | Ga0123353_10766394 | 3300010167 | Bacteria | 1340 |
| 94 | Ga0123353_11882287 | 3300010167 | Bacteria | 739 |
| 95 | Ga0466694_245437 | 3300042594 | Bacteria | 1006 |
| 96 | Ga0466694_368954 | 3300042594 | Bacteria | 2708 |
| 97 | Ga0466696_142073 | 3300042596 | Bacteria | 1055 |
| 98 | Ga0466713_061335 | 3300042602 | Bacteria | 7131 |
| 99 | Ga0466720_206688 | 3300042607 | Unclassified | 1307 |
| 100 | JGI24695J34938_10070426 | 3300002450 | Bacteria | 1463 |
| 101 | Ga0074263_104801 | 3300005485 | Unclassified | 1821 |
| 102 | Ga0466726_073476 | 3300042619 | Bacteria | 2165 |
| 103 | Ga0466728_157148 | 3300042620 | Bacteria | 3901 |
| 104 | Ga0466708_289868 | 3300042652 | Bacteria | 2854 |
| 105 | Ga0466727_143958 | 3300042655 | Bacteria | 4197 |
| 106 | Ga0123353_10027602 | 3300010167 | Bacteria | 8704 |
| 107 | Ga0123353_10155860 | 3300010167 | Bacteria | 3641 |
| 108 | Ga0123353_10334921 | 3300010167 | Bacteria | 2288 |
| 109 | Ga0466690_074183 | 3300042590 | Bacteria | 2291 |
| 110 | Ga0466692_003045 | 3300042591 | Unclassified | 1105 |
| 111 | Ga0466691_012052 | 3300042593 | Bacteria | 30955 |
| 112 | Ga0466694_270563 | 3300042594 | Bacteria | 1590 |
| 113 | Ga0466699_014513 | 3300042597 | Bacteria | 1065 |
| 114 | Ga0466707_244697 | 3300042601 | Bacteria | 1647 |
| 115 | JGI24698J34947_10012239 | 3300002449 | Unclassified | 4704 |
| 116 | JGI24702J35022_10023014 | 3300002462 | Bacteria | 3369 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002462 | JGI24702J35022_10053871 | JGI24702J35022_100538713 | 109 |
| 2 | 3300010167 | Ga0123353_10235361 | Ga0123353_102353613 | 110 |
| 3 | 3300010049 | Ga0123356_10259187 | Ga0123356_102591873 | 112 |
| 4 | 3300041968 | Ga0456237_0004269 | Ga0456237_0004269_1655_1993 | 112 |
| 5 | 3300042599 | Ga0466706_018647 | Ga0466706_018647_3613_3951 | 112 |
| 6 | 3300042619 | Ga0466726_259931 | Ga0466726_259931_6763_7101 | 112 |
| 7 | 3300042621 | Ga0466729_201555 | Ga0466729_201555_567_905 | 112 |
| 8 | 3300042648 | Ga0466709_233804 | Ga0466709_233804_1143_1481 | 112 |
| 9 | 3300024493 | Ga0264413_113462 | Ga0264413_1134623 | 113 |
| 10 | 3300024493 | Ga0264413_113507 | Ga0264413_1135073 | 113 |
| 11 | 3300042590 | Ga0466690_009307 | Ga0466690_009307_8093_8434 | 113 |
| 12 | 3300042590 | Ga0466690_203713 | Ga0466690_203713_3232_3573 | 113 |
| 13 | 3300042591 | Ga0466692_003045 | Ga0466692_003045_14_355 | 113 |
| 14 | 3300042591 | Ga0466692_007920 | Ga0466692_007920_2526_2867 | 113 |
| 15 | 3300042591 | Ga0466692_055496 | Ga0466692_055496_10353_10694 | 113 |
| 16 | 3300042591 | Ga0466692_075907 | Ga0466692_075907_13403_13744 | 113 |
| 17 | 3300042591 | Ga0466692_188500 | Ga0466692_188500_14085_14426 | 113 |
| 18 | 3300042592 | Ga0466693_239088 | Ga0466693_239088_637_978 | 113 |
| 19 | 3300042593 | Ga0466691_012052 | Ga0466691_012052_2695_3036 | 113 |
| 20 | 3300042594 | Ga0466694_072990 | Ga0466694_072990_886_1227 | 113 |
| 21 | 3300042594 | Ga0466694_245437 | Ga0466694_245437_59_400 | 113 |
| 22 | 3300042594 | Ga0466694_268049 | Ga0466694_268049_561_902 | 113 |
| 23 | 3300042594 | Ga0466694_270563 | Ga0466694_270563_834_1175 | 113 |
| 24 | 3300042594 | Ga0466694_271147 | Ga0466694_271147_435_776 | 113 |
| 25 | 3300042594 | Ga0466694_352694 | Ga0466694_352694_585_926 | 113 |
| 26 | 3300042595 | Ga0466695_386991 | Ga0466695_386991_1165_1506 | 113 |
| 27 | 3300042596 | Ga0466696_017564 | Ga0466696_017564_22798_23139 | 113 |
| 28 | 3300042596 | Ga0466696_142073 | Ga0466696_142073_86_427 | 113 |
| 29 | 3300042596 | Ga0466696_207346 | Ga0466696_207346_14682_15023 | 113 |
| 30 | 3300042599 | Ga0466706_259848 | Ga0466706_259848_1024_1365 | 113 |
| 31 | 3300042599 | Ga0466706_289021 | Ga0466706_289021_402_743 | 113 |
| 32 | 3300042601 | Ga0466707_001170 | Ga0466707_001170_1186_1527 | 113 |
| 33 | 3300042601 | Ga0466707_061290 | Ga0466707_061290_612_953 | 113 |
| 34 | 3300042601 | Ga0466707_244697 | Ga0466707_244697_1284_1625 | 113 |
| 35 | 3300042604 | Ga0466717_245603 | Ga0466717_245603_482_823 | 113 |
| 36 | 3300042605 | Ga0466716_177762 | Ga0466716_177762_7061_7402 | 113 |
| 37 | 3300042606 | Ga0466719_047103 | Ga0466719_047103_91_432 | 113 |
| 38 | 3300042606 | Ga0466719_062853 | Ga0466719_062853_12271_12612 | 113 |
| 39 | 3300042607 | Ga0466720_206688 | Ga0466720_206688_115_456 | 113 |
| 40 | 3300042609 | Ga0466722_140791 | Ga0466722_140791_24207_24548 | 113 |
| 41 | 3300042609 | Ga0466722_147288 | Ga0466722_147288_7391_7732 | 113 |
| 42 | 3300042609 | Ga0466722_199067 | Ga0466722_199067_841_1182 | 113 |
| 43 | 3300042614 | Ga0466712_301831 | Ga0466712_301831_771_1112 | 113 |
| 44 | 3300042615 | Ga0466711_019948 | Ga0466711_019948_688_1029 | 113 |
| 45 | 3300042618 | Ga0466723_058149 | Ga0466723_058149_5072_5413 | 113 |
| 46 | 3300042618 | Ga0466723_075462 | Ga0466723_075462_16446_16787 | 113 |
| 47 | 3300042618 | Ga0466723_232250 | Ga0466723_232250_11917_12258 | 113 |
| 48 | 3300042619 | Ga0466726_073476 | Ga0466726_073476_1067_1408 | 113 |
| 49 | 3300042619 | Ga0466726_139804 | Ga0466726_139804_332_673 | 113 |
| 50 | 3300042619 | Ga0466726_428381 | Ga0466726_428381_205_546 | 113 |
| 51 | 3300042620 | Ga0466728_157148 | Ga0466728_157148_2654_2995 | 113 |
| 52 | 3300042620 | Ga0466728_448414 | Ga0466728_448414_82_423 | 113 |
| 53 | 3300042636 | Ga0466703_047869 | Ga0466703_047869_4903_5244 | 113 |
| 54 | 3300042643 | Ga0466704_548688 | Ga0466704_548688_10496_10837 | 113 |
| 55 | 3300042652 | Ga0466708_117267 | Ga0466708_117267_252_593 | 113 |
| 56 | 3300042655 | Ga0466727_004136 | Ga0466727_004136_565_906 | 113 |
| 57 | 3300042655 | Ga0466727_014068 | Ga0466727_014068_486_827 | 113 |
| 58 | 3300042655 | Ga0466727_309398 | Ga0466727_309398_1909_2250 | 113 |
| 59 | iso_pr_bacteria | 2781125652 | 2781311413 | 113 |
| 60 | 3300000089 | AustNasuHG_c1003862 | AustNasuHG_10038624 | 114 |
| 61 | 3300002449 | JGI24698J34947_10012239 | JGI24698J34947_100122392 | 114 |
| 62 | 3300002462 | JGI24702J35022_10003922 | JGI24702J35022_1000392210 | 114 |
| 63 | 3300005485 | Ga0074263_104801 | Ga0074263_1048012 | 114 |
| 64 | 3300009784 | Ga0123357_10012810 | Ga0123357_1001281011 | 114 |
| 65 | 3300009784 | Ga0123357_10137028 | Ga0123357_101370283 | 114 |
| 66 | 3300009784 | Ga0123357_10468633 | Ga0123357_104686332 | 114 |
| 67 | 3300010049 | Ga0123356_10907902 | Ga0123356_109079022 | 114 |
| 68 | 3300010049 | Ga0123356_13064514 | Ga0123356_130645142 | 114 |
| 69 | 3300010167 | Ga0123353_10027602 | Ga0123353_100276024 | 114 |
| 70 | 3300010167 | Ga0123353_10190440 | Ga0123353_101904402 | 114 |
| 71 | 3300010167 | Ga0123353_10334921 | Ga0123353_103349213 | 114 |
| 72 | 3300010167 | Ga0123353_10766394 | Ga0123353_107663942 | 114 |
| 73 | 3300010167 | Ga0123353_11477709 | Ga0123353_114777092 | 114 |
| 74 | 3300010882 | Ga0123354_10326654 | Ga0123354_103266543 | 114 |
| 75 | 3300042612 | Ga0466705_060803 | Ga0466705_060803_4680_5024 | 114 |
| 76 | 3300042612 | Ga0466705_101951 | Ga0466705_101951_504_848 | 114 |
| 77 | 3300042616 | Ga0466715_115149 | Ga0466715_115149_3878_4222 | 114 |
| 78 | 3300042616 | Ga0466715_224666 | Ga0466715_224666_4210_4554 | 114 |
| 79 | 3300042618 | Ga0466723_100064 | Ga0466723_100064_12931_13275 | 114 |
| 80 | 3300042636 | Ga0466703_181719 | Ga0466703_181719_4927_5271 | 114 |
| 81 | 3300042590 | Ga0466690_074183 | Ga0466690_074183_269_616 | 115 |
| 82 | 3300042615 | Ga0466711_225682 | Ga0466711_225682_6390_6737 | 115 |
| 83 | 3300042636 | Ga0466703_111746 | Ga0466703_111746_27963_28310 | 115 |
| 84 | 3300042655 | Ga0466727_061245 | Ga0466727_061245_1627_1974 | 115 |
| 85 | 3300042643 | Ga0466704_133824 | Ga0466704_133824_7806_8156 | 116 |
| 86 | 3300042594 | Ga0466694_185248 | Ga0466694_185248_798_1151 | 117 |
| 87 | 3300042594 | Ga0466694_368954 | Ga0466694_368954_937_1290 | 117 |
| 88 | 3300042597 | Ga0466699_014513 | Ga0466699_014513_128_481 | 117 |
| 89 | 3300042597 | Ga0466699_051184 | Ga0466699_051184_1030_1383 | 117 |
| 90 | 3300042597 | Ga0466699_080147 | Ga0466699_080147_55_408 | 117 |
| 91 | 3300042597 | Ga0466699_442807 | Ga0466699_442807_95_448 | 117 |
| 92 | 3300042605 | Ga0466716_360111 | Ga0466716_360111_457_810 | 117 |
| 93 | 3300042612 | Ga0466705_445603 | Ga0466705_445603_10416_10769 | 117 |
| 94 | 3300042615 | Ga0466711_287450 | Ga0466711_287450_266_619 | 117 |
| 95 | 3300042622 | Ga0466731_239174 | Ga0466731_239174_3119_3472 | 117 |
| 96 | 3300042652 | Ga0466708_080262 | Ga0466708_080262_4358_4711 | 117 |
| 97 | 3300042652 | Ga0466708_289868 | Ga0466708_289868_1392_1745 | 117 |
| 98 | 3300042655 | Ga0466727_143958 | Ga0466727_143958_3715_4068 | 117 |
| 99 | 2030936001 | Nasutiter_Contig34270 | Nasutiterm_781470 | 118 |
| 100 | 3300002450 | JGI24695J34938_10070426 | JGI24695J34938_100704262 | 118 |
| 101 | 3300010049 | Ga0123356_10194502 | Ga0123356_101945022 | 118 |
| 102 | 3300010167 | Ga0123353_10041766 | Ga0123353_100417663 | 118 |
| 103 | 3300010167 | Ga0123353_10486539 | Ga0123353_104865393 | 118 |
| 104 | 3300010167 | Ga0123353_10569638 | Ga0123353_105696383 | 118 |
| 105 | 3300010882 | Ga0123354_10318110 | Ga0123354_103181102 | 118 |
| 106 | 3300042643 | Ga0466704_225547 | Ga0466704_225547_3501_3857 | 118 |
| 107 | 3300042616 | Ga0466715_549812 | Ga0466715_549812_3616_3975 | 119 |
| 108 | 3300010167 | Ga0123353_11882287 | Ga0123353_118822871 | 120 |
| 109 | 3300002504 | JGI24705J35276_12150850 | JGI24705J35276_121508502 | 121 |
| 110 | 3300009784 | Ga0123357_10468566 | Ga0123357_104685662 | 122 |
| 111 | 3300010167 | Ga0123353_10155860 | Ga0123353_101558602 | 122 |
| 112 | 3300042602 | Ga0466713_057497 | Ga0466713_057497_1049_1417 | 122 |
| 113 | 3300042602 | Ga0466713_061335 | Ga0466713_061335_3589_3957 | 122 |
| 114 | 2030936001 | Nasutiter_Contig00976 | Nasutiterm_346260 | 132 |
| 115 | 3300002462 | JGI24702J35022_10023014 | JGI24702J35022_100230143 | 132 |
| 116 | 3300010167 | Ga0123353_11645912 | Ga0123353_116459122 | 136 |
| 117 | 3300010882 | Ga0123354_10289886 | Ga0123354_102898862 | 136 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01990 | ATP-synt_F | ATP synthase (F/14-kDa) subunit | 5 | 40 | 0.91 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.