Protein Family IF03542
Metagenome
Isolate
177
Members
55
Samples
170
Scaffolds
377.58
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10287291|Ga0123354_102872911
- Length
- 406 aa
- Sequence
- MKNPFLVSGYISKEYFCDRVEESKNLLKLVTNGNNVLLVSPRRMGKTGLIEHCFRNPNIKKDYYTFFVDIYATSNLQTFTYKLGKEIFNQLKPKGKKFLENFFAIISSLRPAFKLDENSGAPVFDIGIGEIRSPEFTLEEIFKYLNLSDKPCIIAIDEFQQIAKYPEKNIEATLRTHIQKTTNSAFIFSGSQRHILHEMFFSASKPFYQSAVLQSLDVICKSEYIKFASNLFKKGKKIVDNSFIEKAYYLFEGHTFYVQSVLNQLFSELDENEKCTNKIFEKAVINRIFSYNTLFSEILNLLPDRQKECLYAIAKEGKTTNITSGDFVKKHALHSSASVQTAVRQLIDKELLTKNLNIYSVYDRFFDFWLKSNFGAVELLNLDKFIYRTEAKITLSHTPPTTAKL*
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
23.6%
Unclassified
12.7%
Termopsidae
7.3%
Blattidae
3.6%
Passalidae
3.6%
Hodotermitidae
1.8%
Rhinotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 49 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_071506 | 3300042611 | Bacteria | 1914 |
| 2 | Ga0466705_034044 | 3300042612 | Bacteria | 7941 |
| 3 | Ga0466732_384214 | 3300042656 | Bacteria | 4051 |
| 4 | Ga0466733_067078 | 3300042659 | Bacteria | 1805 |
| 5 | Ga0466733_079693 | 3300042659 | Bacteria | 2760 |
| 6 | Ga0466700_412142 | 3300042600 | Bacteria | 2389 |
| 7 | Ga0466707_380382 | 3300042601 | Bacteria | 3255 |
| 8 | Ga0466713_102712 | 3300042602 | Bacteria | 2486 |
| 9 | Ga0466714_044522 | 3300042603 | Bacteria | 3863 |
| 10 | Ga0466714_055475 | 3300042603 | Bacteria | 1877 |
| 11 | Ga0466716_475296 | 3300042605 | Bacteria | 9321 |
| 12 | Ga0466721_366049 | 3300042608 | Bacteria | 1726 |
| 13 | Ga0466697_029076 | 3300042611 | Unclassified | 1296 |
| 14 | Ga0466711_380688 | 3300042615 | Bacteria | 2554 |
| 15 | Ga0466715_259752 | 3300042616 | Bacteria | 10916 |
| 16 | Ga0466728_327582 | 3300042620 | Bacteria | 2659 |
| 17 | Ga0123353_10392416 | 3300010167 | Bacteria | 2070 |
| 18 | Ga0123354_10027097 | 3300010882 | Bacteria | 9029 |
| 19 | JGI24702J35022_10079708 | 3300002462 | Bacteria | 1773 |
| 20 | Ga0466735_178770 | 3300042624 | Bacteria | 6435 |
| 21 | Ga0466703_410448 | 3300042636 | Bacteria | 5080 |
| 22 | Ga0466708_256148 | 3300042652 | Bacteria | 12361 |
| 23 | Ga0466693_093133 | 3300042592 | Bacteria | 4147 |
| 24 | Ga0466693_186062 | 3300042592 | Bacteria | 2583 |
| 25 | Ga0466691_101231 | 3300042593 | Bacteria | 36706 |
| 26 | Ga0466694_313844 | 3300042594 | Bacteria | 2567 |
| 27 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 28 | Ga0466697_249115 | 3300042611 | Bacteria | 2566 |
| 29 | Ga0466733_053141 | 3300042659 | Bacteria | 3010 |
| 30 | Ga0466701_051553 | 3300042598 | Bacteria | 4279 |
| 31 | Ga0466706_168401 | 3300042599 | Bacteria | 37088 |
| 32 | Ga0466707_296698 | 3300042601 | Bacteria | 7410 |
| 33 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 34 | Ga0466714_000481 | 3300042603 | Bacteria | 4827 |
| 35 | Ga0466714_042673 | 3300042603 | Bacteria | 2837 |
| 36 | Ga0466714_095243 | 3300042603 | Bacteria | 9628 |
| 37 | Ga0466714_105823 | 3300042603 | Bacteria | 2072 |
| 38 | Ga0466710_401048 | 3300042613 | Bacteria | 1740 |
| 39 | Ga0466726_066658 | 3300042619 | Bacteria | 3184 |
| 40 | Ga0466728_455315 | 3300042620 | Bacteria | 12268 |
| 41 | Ga0123357_10011387 | 3300009784 | Bacteria | 11399 |
| 42 | Ga0123357_10032404 | 3300009784 | Bacteria | 7098 |
| 43 | Ga0123353_10031880 | 3300010167 | Bacteria | 8174 |
| 44 | Ga0123354_10025192 | 3300010882 | Bacteria | 9382 |
| 45 | 2227516606 | 2225789004 | Bacteria | 3428 |
| 46 | 2227564093 | 2225789004 | Bacteria | 2692 |
| 47 | IMNBL1DRAFT_c0000470 | 3300000062 | Bacteria | 33673 |
| 48 | JGI24705J35276_12237597 | 3300002504 | Bacteria | 12007 |
| 49 | Ga0068305_10175092 | 3300005083 | Bacteria | 2968 |
| 50 | Ga0466731_056869 | 3300042622 | Bacteria | 2214 |
| 51 | Ga0466727_182475 | 3300042655 | Bacteria | 5952 |
| 52 | Ga0466695_305689 | 3300042595 | Bacteria | 1525 |
| 53 | Ga0466697_106599 | 3300042611 | Bacteria | 91903 |
| 54 | Ga0466701_077922 | 3300042598 | Bacteria | 7465 |
| 55 | Ga0466701_095154 | 3300042598 | Bacteria | 4559 |
| 56 | Ga0466706_275233 | 3300042599 | Bacteria | 4023 |
| 57 | Ga0466707_280552 | 3300042601 | Bacteria | 12628 |
| 58 | Ga0466713_113556 | 3300042602 | Bacteria | 1869 |
| 59 | Ga0466714_002562 | 3300042603 | Bacteria | 43787 |
| 60 | Ga0466714_106484 | 3300042603 | Bacteria | 3459 |
| 61 | Ga0466714_161383 | 3300042603 | Bacteria | 3286 |
| 62 | Ga0466717_046974 | 3300042604 | Bacteria | 1722 |
| 63 | Ga0466710_121363 | 3300042613 | Bacteria | 20587 |
| 64 | Ga0466726_238722 | 3300042619 | Bacteria | 1986 |
| 65 | Ga0123354_10294246 | 3300010882 | Unclassified | 1549 |
| 66 | IMNBL1DRAFT_c0008325 | 3300000062 | Bacteria | 5293 |
| 67 | IMNBL1DRAFT_c0015400 | 3300000062 | Bacteria | 3320 |
| 68 | IMNBL1DRAFT_c0018361 | 3300000062 | Bacteria | 2911 |
| 69 | IMNBL1DRAFT_c0031095 | 3300000062 | Bacteria | 1947 |
| 70 | JGI24702J35022_10026714 | 3300002462 | Bacteria | 3109 |
| 71 | JGI24705J35276_12192424 | 3300002504 | Bacteria | 1487 |
| 72 | JGI24705J35276_12194572 | 3300002504 | Bacteria | 1514 |
| 73 | JGI24705J35276_12225719 | 3300002504 | Bacteria | 2758 |
| 74 | Ga0466727_237611 | 3300042655 | Unclassified | 5116 |
| 75 | Ga0466657_263307 | 3300042582 | Bacteria | 3263 |
| 76 | Ga0466693_237173 | 3300042592 | Bacteria | 1509 |
| 77 | Ga0466733_083813 | 3300042659 | Bacteria | 3197 |
| 78 | Ga0466733_094871 | 3300042659 | Bacteria | 3458 |
| 79 | Ga0466719_137926 | 3300042606 | Bacteria | 4046 |
| 80 | Ga0466719_152702 | 3300042606 | Bacteria | 3735 |
| 81 | Ga0466721_185891 | 3300042608 | Bacteria | 28527 |
| 82 | Ga0466722_214552 | 3300042609 | Bacteria | 5685 |
| 83 | Ga0466726_239743 | 3300042619 | Bacteria | 4373 |
| 84 | 2227200831 | 2225789004 | Bacteria | 1439 |
| 85 | 2227524073 | 2225789004 | Bacteria | 3282 |
| 86 | JGI24702J35022_10084712 | 3300002462 | Bacteria | 1720 |
| 87 | Ga0068302_10257591 | 3300005071 | Bacteria | 1214 |
| 88 | Ga0466735_103628 | 3300042624 | Bacteria | 1592 |
| 89 | Ga0466727_027143 | 3300042655 | Bacteria | 7690 |
| 90 | Ga0466727_264807 | 3300042655 | Bacteria | 1315 |
| 91 | Ga0466696_210339 | 3300042596 | Bacteria | 2726 |
| 92 | Ga0466733_065070 | 3300042659 | Bacteria | 1530 |
| 93 | Ga0466714_029318 | 3300042603 | Bacteria | 2350 |
| 94 | Ga0466714_088607 | 3300042603 | Bacteria | 2805 |
| 95 | Ga0123353_10092186 | 3300010167 | Bacteria | 4880 |
| 96 | 2227507947 | 2225789004 | Bacteria | 71292 |
| 97 | 2227535714 | 2225789004 | Bacteria | 63282 |
| 98 | IMNBL1DRAFT_c0004649 | 3300000062 | Bacteria | 8149 |
| 99 | Ga0466731_126869 | 3300042622 | Bacteria | 9260 |
| 100 | Ga0466731_330205 | 3300042622 | Bacteria | 4410 |
| 101 | Ga0466691_040836 | 3300042593 | Bacteria | 24285 |
| 102 | Ga0466696_095898 | 3300042596 | Bacteria | 8814 |
| 103 | Ga0466705_370959 | 3300042612 | Bacteria | 1538 |
| 104 | Ga0466733_080596 | 3300042659 | Archaea | 2728 |
| 105 | Ga0466700_202345 | 3300042600 | Bacteria | 1829 |
| 106 | Ga0466707_005791 | 3300042601 | Bacteria | 3142 |
| 107 | Ga0466707_249660 | 3300042601 | Bacteria | 1226 |
| 108 | Ga0466714_001491 | 3300042603 | Bacteria | 1231 |
| 109 | Ga0466714_043311 | 3300042603 | Bacteria | 4363 |
| 110 | Ga0466714_054166 | 3300042603 | Bacteria | 10984 |
| 111 | Ga0466717_150381 | 3300042604 | Bacteria | 3571 |
| 112 | Ga0466720_156027 | 3300042607 | Bacteria | 3070 |
| 113 | Ga0466698_127960 | 3300042610 | Bacteria | 1910 |
| 114 | Ga0466711_296882 | 3300042615 | Bacteria | 1895 |
| 115 | Ga0466711_426184 | 3300042615 | Bacteria | 1319 |
| 116 | Ga0466715_367602 | 3300042616 | Bacteria | 6011 |
| 117 | Ga0466726_272855 | 3300042619 | Bacteria | 3623 |
| 118 | Ga0466726_328018 | 3300042619 | Bacteria | 5470 |
| 119 | Ga0123356_10255392 | 3300010049 | Bacteria | 1833 |
| 120 | Ga0123353_10496840 | 3300010167 | Bacteria | 1779 |
| 121 | Ga0123353_10547632 | 3300010167 | Bacteria | 1670 |
| 122 | Ga0123354_10229682 | 3300010882 | Bacteria | 1944 |
| 123 | Ga0123354_10289314 | 3300010882 | Bacteria | 1574 |
| 124 | JGI24702J35022_10026880 | 3300002462 | Bacteria | 3096 |
| 125 | Ga0068302_10010226 | 3300005071 | Unclassified | 5799 |
| 126 | Ga0466734_013579 | 3300042623 | Bacteria | 1423 |
| 127 | Ga0466704_318418 | 3300042643 | Bacteria | 10089 |
| 128 | Ga0466697_198141 | 3300042611 | Bacteria | 1093 |
| 129 | Ga0466697_228243 | 3300042611 | Bacteria | 3789 |
| 130 | Ga0466701_069369 | 3300042598 | Bacteria | 58155 |
| 131 | Ga0466701_097399 | 3300042598 | Bacteria | 121087 |
| 132 | Ga0466713_043928 | 3300042602 | Bacteria | 2825 |
| 133 | Ga0466714_009868 | 3300042603 | Bacteria | 1423 |
| 134 | Ga0466714_067543 | 3300042603 | Bacteria | 3988 |
| 135 | Ga0466714_077709 | 3300042603 | Bacteria | 26910 |
| 136 | Ga0466721_010295 | 3300042608 | Bacteria | 2118 |
| 137 | Ga0466698_159015 | 3300042610 | Bacteria | 1196 |
| 138 | Ga0466698_468653 | 3300042610 | Bacteria | 4082 |
| 139 | Ga0466710_093479 | 3300042613 | Bacteria | 3843 |
| 140 | Ga0123353_10326915 | 3300010167 | Bacteria | 2324 |
| 141 | Ga0123353_10487413 | 3300010167 | Bacteria | 1801 |
| 142 | Ga0123354_10137306 | 3300010882 | Bacteria | 3049 |
| 143 | 2227488538 | 2225789004 | Bacteria | 20664 |
| 144 | JGI24702J35022_10012176 | 3300002462 | Bacteria | 4787 |
| 145 | JGI24702J35022_10038491 | 3300002462 | Bacteria | 2553 |
| 146 | Ga0466709_165161 | 3300042648 | Bacteria | 19220 |
| 147 | Ga0466724_07002 | 3300042649 | Bacteria | 1573 |
| 148 | Ga0466727_184040 | 3300042655 | Bacteria | 7230 |
| 149 | Ga0466690_067366 | 3300042590 | Bacteria | 2716 |
| 150 | Ga0466691_175433 | 3300042593 | Bacteria | 4900 |
| 151 | Ga0466705_105693 | 3300042612 | Bacteria | 24317 |
| 152 | Ga0466733_008626 | 3300042659 | Bacteria | 66692 |
| 153 | Ga0466733_031197 | 3300042659 | Bacteria | 2770 |
| 154 | Ga0466733_091567 | 3300042659 | Bacteria | 1302 |
| 155 | Ga0466706_252340 | 3300042599 | Bacteria | 21739 |
| 156 | Ga0466713_114189 | 3300042602 | Bacteria | 34018 |
| 157 | Ga0466714_039580 | 3300042603 | Bacteria | 1369 |
| 158 | Ga0466714_165957 | 3300042603 | Bacteria | 2232 |
| 159 | Ga0466710_013187 | 3300042613 | Unclassified | 1355 |
| 160 | Ga0466711_306525 | 3300042615 | Bacteria | 2201 |
| 161 | Ga0123354_10008251 | 3300010882 | Bacteria | 15818 |
| 162 | Ga0123354_10287291 | 3300010882 | Unclassified | 1584 |
| 163 | 2227560719 | 2225789004 | Bacteria | 14591 |
| 164 | JGI24702J35022_10036427 | 3300002462 | Bacteria | 2629 |
| 165 | JGI24696J40584_12944762 | 3300002834 | Bacteria | 1824 |
| 166 | Ga0068305_10004417 | 3300005083 | Bacteria | 55018 |
| 167 | Ga0068305_10721600 | 3300005083 | Bacteria | 1946 |
| 168 | Ga0466731_011055 | 3300042622 | Bacteria | 1738 |
| 169 | Ga0466690_059220 | 3300042590 | Bacteria | 6143 |
| 170 | Ga0466691_024990 | 3300042593 | Bacteria | 118277 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042603 | Ga0466714_039580 | Ga0466714_039580_108_1091 | 327 |
| 2 | 3300042610 | Ga0466698_159015 | Ga0466698_159015_194_1186 | 330 |
| 3 | 3300042611 | Ga0466697_198141 | Ga0466697_198141_32_1024 | 330 |
| 4 | 3300042623 | Ga0466734_013579 | Ga0466734_013579_44_1042 | 332 |
| 5 | 3300010167 | Ga0123353_10392416 | Ga0123353_103924162 | 338 |
| 6 | 3300042615 | Ga0466711_380688 | Ga0466711_380688_39_1058 | 339 |
| 7 | 3300042602 | Ga0466713_102712 | Ga0466713_102712_28_1056 | 342 |
| 8 | 3300042582 | Ga0466657_263307 | Ga0466657_263307_25_1059 | 344 |
| 9 | 3300042607 | Ga0466720_156027 | Ga0466720_156027_1980_3014 | 344 |
| 10 | 3300042615 | Ga0466711_306525 | Ga0466711_306525_28_1068 | 346 |
| 11 | 3300042659 | Ga0466733_053141 | Ga0466733_053141_902_1948 | 348 |
| 12 | 3300005083 | Ga0068305_10004417 | Ga0068305_1000441712 | 351 |
| 13 | 3300042603 | Ga0466714_001491 | Ga0466714_001491_152_1207 | 351 |
| 14 | 3300042619 | Ga0466726_238722 | Ga0466726_238722_597_1751 | 357 |
| 15 | 3300042603 | Ga0466714_042673 | Ga0466714_042673_120_1196 | 358 |
| 16 | 3300042603 | Ga0466714_077709 | Ga0466714_077709_15924_17057 | 360 |
| 17 | 3300042592 | Ga0466693_186062 | Ga0466693_186062_245_1375 | 370 |
| 18 | 3300042601 | Ga0466707_296698 | Ga0466707_296698_6139_7254 | 371 |
| 19 | 3300042602 | Ga0466713_037944 | Ga0466713_037944_56472_57593 | 373 |
| 20 | 3300042655 | Ga0466727_184040 | Ga0466727_184040_1366_2487 | 373 |
| 21 | 3300042598 | Ga0466701_097399 | Ga0466701_097399_82223_83347 | 374 |
| 22 | 3300042600 | Ga0466700_412142 | Ga0466700_412142_910_2034 | 374 |
| 23 | 3300042603 | Ga0466714_165957 | Ga0466714_165957_160_1284 | 374 |
| 24 | 3300042611 | Ga0466697_179409 | Ga0466697_179409_42478_43602 | 374 |
| 25 | 3300042613 | Ga0466710_013187 | Ga0466710_013187_34_1158 | 374 |
| 26 | 3300042655 | Ga0466727_027143 | Ga0466727_027143_4062_5186 | 374 |
| 27 | 3300042659 | Ga0466733_031197 | Ga0466733_031197_1171_2295 | 374 |
| 28 | 3300042659 | Ga0466733_067078 | Ga0466733_067078_389_1513 | 374 |
| 29 | 3300042601 | Ga0466707_380382 | Ga0466707_380382_2051_3178 | 375 |
| 30 | 2225789004 | 2227516606 | 2228016124 | 376 |
| 31 | 3300000062 | IMNBL1DRAFT_c0008325 | IMNBL1DRAFT_00083253 | 376 |
| 32 | 3300042590 | Ga0466690_067366 | Ga0466690_067366_275_1405 | 376 |
| 33 | 3300042592 | Ga0466693_093133 | Ga0466693_093133_2754_3884 | 376 |
| 34 | 3300042593 | Ga0466691_024990 | Ga0466691_024990_100001_101131 | 376 |
| 35 | 3300042596 | Ga0466696_095898 | Ga0466696_095898_7296_8426 | 376 |
| 36 | 3300042600 | Ga0466700_202345 | Ga0466700_202345_229_1359 | 376 |
| 37 | 3300042604 | Ga0466717_046974 | Ga0466717_046974_448_1578 | 376 |
| 38 | 3300042604 | Ga0466717_150381 | Ga0466717_150381_361_1491 | 376 |
| 39 | 3300042608 | Ga0466721_366049 | Ga0466721_366049_134_1264 | 376 |
| 40 | 3300042611 | Ga0466697_106599 | Ga0466697_106599_27217_28347 | 376 |
| 41 | 3300042612 | Ga0466705_105693 | Ga0466705_105693_8406_9536 | 376 |
| 42 | 3300042612 | Ga0466705_370959 | Ga0466705_370959_101_1231 | 376 |
| 43 | 3300042613 | Ga0466710_093479 | Ga0466710_093479_2438_3568 | 376 |
| 44 | 3300042613 | Ga0466710_121363 | Ga0466710_121363_10332_11462 | 376 |
| 45 | 3300042615 | Ga0466711_296882 | Ga0466711_296882_10_1140 | 376 |
| 46 | 3300042615 | Ga0466711_426184 | Ga0466711_426184_10_1140 | 376 |
| 47 | 3300042616 | Ga0466715_367602 | Ga0466715_367602_277_1407 | 376 |
| 48 | 3300042619 | Ga0466726_328018 | Ga0466726_328018_1818_2948 | 376 |
| 49 | 3300042620 | Ga0466728_455315 | Ga0466728_455315_10860_11990 | 376 |
| 50 | 3300042622 | Ga0466731_330205 | Ga0466731_330205_2161_3291 | 376 |
| 51 | 3300042636 | Ga0466703_410448 | Ga0466703_410448_3209_4339 | 376 |
| 52 | 3300042643 | Ga0466704_318418 | Ga0466704_318418_4287_5417 | 376 |
| 53 | 3300042649 | Ga0466724_07002 | Ga0466724_07002_133_1263 | 376 |
| 54 | 3300042652 | Ga0466708_256148 | Ga0466708_256148_6536_7666 | 376 |
| 55 | 3300042655 | Ga0466727_237611 | Ga0466727_237611_2012_3142 | 376 |
| 56 | iso_pr_bacteria | 2820753519 | 2820754981 | 376 |
| 57 | iso_pr_bacteria | 2820755292 | 2820755382 | 376 |
| 58 | 3300002504 | JGI24705J35276_12192424 | JGI24705J35276_121924241 | 377 |
| 59 | 3300002504 | JGI24705J35276_12194572 | JGI24705J35276_121945721 | 377 |
| 60 | 3300002504 | JGI24705J35276_12237597 | JGI24705J35276_1223759712 | 377 |
| 61 | 3300005071 | Ga0068302_10257591 | Ga0068302_102575911 | 377 |
| 62 | 3300010049 | Ga0123356_10255392 | Ga0123356_102553922 | 377 |
| 63 | 3300010167 | Ga0123353_10031880 | Ga0123353_100318806 | 377 |
| 64 | 3300010882 | Ga0123354_10025192 | Ga0123354_100251926 | 377 |
| 65 | 3300010882 | Ga0123354_10027097 | Ga0123354_100270972 | 377 |
| 66 | 3300042593 | Ga0466691_040836 | Ga0466691_040836_19426_20559 | 377 |
| 67 | 3300042603 | Ga0466714_002562 | Ga0466714_002562_8547_9680 | 377 |
| 68 | 3300042605 | Ga0466716_475296 | Ga0466716_475296_2881_4014 | 377 |
| 69 | 3300042608 | Ga0466721_010295 | Ga0466721_010295_131_1264 | 377 |
| 70 | 3300042609 | Ga0466722_214552 | Ga0466722_214552_3887_5020 | 377 |
| 71 | 3300042612 | Ga0466705_034044 | Ga0466705_034044_2549_3682 | 377 |
| 72 | iso_pr_bacteria | 2820772500 | 2820773322 | 377 |
| 73 | 3300010167 | Ga0123353_10092186 | Ga0123353_100921862 | 378 |
| 74 | 3300042593 | Ga0466691_101231 | Ga0466691_101231_23520_24656 | 378 |
| 75 | 3300042595 | Ga0466695_305689 | Ga0466695_305689_211_1347 | 378 |
| 76 | 3300042596 | Ga0466696_210339 | Ga0466696_210339_351_1487 | 378 |
| 77 | 3300042598 | Ga0466701_069369 | Ga0466701_069369_43149_44285 | 378 |
| 78 | 3300042598 | Ga0466701_095154 | Ga0466701_095154_218_1354 | 378 |
| 79 | 3300042602 | Ga0466713_043928 | Ga0466713_043928_1113_2249 | 378 |
| 80 | 3300042602 | Ga0466713_113556 | Ga0466713_113556_394_1530 | 378 |
| 81 | 3300042606 | Ga0466719_137926 | Ga0466719_137926_2585_3721 | 378 |
| 82 | 3300042608 | Ga0466721_185891 | Ga0466721_185891_661_1797 | 378 |
| 83 | 3300042610 | Ga0466698_127960 | Ga0466698_127960_755_1891 | 378 |
| 84 | 3300042616 | Ga0466715_259752 | Ga0466715_259752_1421_2557 | 378 |
| 85 | 3300042622 | Ga0466731_011055 | Ga0466731_011055_448_1584 | 378 |
| 86 | 3300042624 | Ga0466735_103628 | Ga0466735_103628_439_1575 | 378 |
| 87 | 3300042656 | Ga0466732_384214 | Ga0466732_384214_2079_3215 | 378 |
| 88 | 3300042659 | Ga0466733_091567 | Ga0466733_091567_85_1221 | 378 |
| 89 | iso_pr_bacteria | 2967483437 | 2967483750 | 378 |
| 90 | 3300002462 | JGI24702J35022_10026714 | JGI24702J35022_100267143 | 379 |
| 91 | 3300002462 | JGI24702J35022_10036427 | JGI24702J35022_100364272 | 379 |
| 92 | 3300002462 | JGI24702J35022_10038491 | JGI24702J35022_100384912 | 379 |
| 93 | 3300002462 | JGI24702J35022_10079708 | JGI24702J35022_100797082 | 379 |
| 94 | 3300002834 | JGI24696J40584_12944762 | JGI24696J40584_129447622 | 379 |
| 95 | 3300010167 | Ga0123353_10326915 | Ga0123353_103269152 | 379 |
| 96 | 3300010882 | Ga0123354_10229682 | Ga0123354_102296821 | 379 |
| 97 | 3300010882 | Ga0123354_10289314 | Ga0123354_102893141 | 379 |
| 98 | 3300042594 | Ga0466694_313844 | Ga0466694_313844_693_1832 | 379 |
| 99 | 3300042602 | Ga0466713_114189 | Ga0466713_114189_3382_4521 | 379 |
| 100 | 3300009784 | Ga0123357_10011387 | Ga0123357_100113876 | 380 |
| 101 | 3300010882 | Ga0123354_10008251 | Ga0123354_1000825112 | 380 |
| 102 | 3300042592 | Ga0466693_237173 | Ga0466693_237173_85_1227 | 380 |
| 103 | 3300042598 | Ga0466701_051553 | Ga0466701_051553_1536_2678 | 380 |
| 104 | 3300042601 | Ga0466707_249660 | Ga0466707_249660_21_1163 | 380 |
| 105 | 3300042611 | Ga0466697_228243 | Ga0466697_228243_2583_3725 | 380 |
| 106 | 3300042613 | Ga0466710_401048 | Ga0466710_401048_70_1212 | 380 |
| 107 | 3300042622 | Ga0466731_056869 | Ga0466731_056869_490_1632 | 380 |
| 108 | 3300042648 | Ga0466709_165161 | Ga0466709_165161_9341_10483 | 380 |
| 109 | 3300002504 | JGI24705J35276_12225719 | JGI24705J35276_122257192 | 381 |
| 110 | 3300009784 | Ga0123357_10032404 | Ga0123357_100324046 | 381 |
| 111 | 3300010882 | Ga0123354_10137306 | Ga0123354_101373063 | 381 |
| 112 | 3300010882 | Ga0123354_10294246 | Ga0123354_102942462 | 381 |
| 113 | 3300042593 | Ga0466691_175433 | Ga0466691_175433_2875_4020 | 381 |
| 114 | 3300042601 | Ga0466707_005791 | Ga0466707_005791_556_1701 | 381 |
| 115 | 3300042603 | Ga0466714_044522 | Ga0466714_044522_129_1274 | 381 |
| 116 | 3300005083 | Ga0068305_10175092 | Ga0068305_101750921 | 382 |
| 117 | 3300005083 | Ga0068305_10721600 | Ga0068305_107216001 | 382 |
| 118 | 3300042655 | Ga0466727_182475 | Ga0466727_182475_1806_2954 | 382 |
| 119 | 2225789004 | 2227488538 | 2227957856 | 383 |
| 120 | 2225789004 | 2227524073 | 2228030069 | 383 |
| 121 | 2225789004 | 2227564093 | 2228104426 | 383 |
| 122 | 3300002462 | JGI24702J35022_10012176 | JGI24702J35022_100121765 | 383 |
| 123 | 3300002462 | JGI24702J35022_10084712 | JGI24702J35022_100847121 | 383 |
| 124 | 3300042590 | Ga0466690_059220 | Ga0466690_059220_1164_2315 | 383 |
| 125 | 3300042599 | Ga0466706_275233 | Ga0466706_275233_2070_3221 | 383 |
| 126 | 3300042619 | Ga0466726_066658 | Ga0466726_066658_271_1422 | 383 |
| 127 | 3300042624 | Ga0466735_178770 | Ga0466735_178770_73_1224 | 383 |
| 128 | 3300042655 | Ga0466727_182475 | Ga0466727_182475_520_1671 | 383 |
| 129 | 2225789004 | 2227200831 | 2227626447 | 384 |
| 130 | 3300000062 | IMNBL1DRAFT_c0015400 | IMNBL1DRAFT_00154003 | 384 |
| 131 | 3300000062 | IMNBL1DRAFT_c0018361 | IMNBL1DRAFT_00183612 | 384 |
| 132 | 3300005071 | Ga0068302_10010226 | Ga0068302_100102262 | 384 |
| 133 | 3300042601 | Ga0466707_280552 | Ga0466707_280552_1045_2199 | 384 |
| 134 | 3300042603 | Ga0466714_043311 | Ga0466714_043311_881_2035 | 384 |
| 135 | 3300042603 | Ga0466714_067543 | Ga0466714_067543_1931_3085 | 384 |
| 136 | 3300042603 | Ga0466714_088607 | Ga0466714_088607_268_1422 | 384 |
| 137 | 3300042603 | Ga0466714_095243 | Ga0466714_095243_929_2083 | 384 |
| 138 | 3300042655 | Ga0466727_264807 | Ga0466727_264807_73_1227 | 384 |
| 139 | 3300042659 | Ga0466733_065070 | Ga0466733_065070_237_1391 | 384 |
| 140 | 3300042659 | Ga0466733_080596 | Ga0466733_080596_992_2164 | 384 |
| 141 | 3300042659 | Ga0466733_083813 | Ga0466733_083813_1559_2713 | 384 |
| 142 | 3300042659 | Ga0466733_094871 | Ga0466733_094871_1057_2211 | 384 |
| 143 | iso_pr_bacteria | 2940195863 | 2940196416 | 384 |
| 144 | iso_pr_bacteria | 2940202316 | 2940202661 | 384 |
| 145 | 3300000062 | IMNBL1DRAFT_c0000470 | IMNBL1DRAFT_000047029 | 385 |
| 146 | 3300000062 | IMNBL1DRAFT_c0004649 | IMNBL1DRAFT_000464910 | 385 |
| 147 | 3300042599 | Ga0466706_252340 | Ga0466706_252340_17405_18562 | 385 |
| 148 | 3300042619 | Ga0466726_239743 | Ga0466726_239743_1458_2615 | 385 |
| 149 | 2225789004 | 2227507947 | 2227997922 | 386 |
| 150 | 2225789004 | 2227560719 | 2228097148 | 386 |
| 151 | 3300042598 | Ga0466701_077922 | Ga0466701_077922_4576_5736 | 386 |
| 152 | 3300042603 | Ga0466714_009868 | Ga0466714_009868_13_1173 | 386 |
| 153 | 3300042603 | Ga0466714_029318 | Ga0466714_029318_971_2131 | 386 |
| 154 | 3300042611 | Ga0466697_071506 | Ga0466697_071506_426_1586 | 386 |
| 155 | 3300042622 | Ga0466731_126869 | Ga0466731_126869_4080_5240 | 386 |
| 156 | 2225789004 | 2227535714 | 2228051533 | 387 |
| 157 | 3300000062 | IMNBL1DRAFT_c0031095 | IMNBL1DRAFT_00310952 | 387 |
| 158 | 3300042603 | Ga0466714_000481 | Ga0466714_000481_1463_2626 | 387 |
| 159 | 3300042603 | Ga0466714_054166 | Ga0466714_054166_5357_6520 | 387 |
| 160 | 3300042603 | Ga0466714_106484 | Ga0466714_106484_2000_3163 | 387 |
| 161 | 3300042606 | Ga0466719_152702 | Ga0466719_152702_2199_3362 | 387 |
| 162 | 3300042611 | Ga0466697_249115 | Ga0466697_249115_462_1625 | 387 |
| 163 | 3300042599 | Ga0466706_168401 | Ga0466706_168401_12267_13448 | 388 |
| 164 | 3300042603 | Ga0466714_105823 | Ga0466714_105823_140_1306 | 388 |
| 165 | 3300042611 | Ga0466697_029076 | Ga0466697_029076_54_1220 | 388 |
| 166 | 3300042620 | Ga0466728_327582 | Ga0466728_327582_1167_2333 | 388 |
| 167 | 3300042610 | Ga0466698_468653 | Ga0466698_468653_2267_3439 | 390 |
| 168 | 3300042603 | Ga0466714_055475 | Ga0466714_055475_452_1627 | 391 |
| 169 | 3300002462 | JGI24702J35022_10026880 | JGI24702J35022_100268803 | 392 |
| 170 | 3300042603 | Ga0466714_161383 | Ga0466714_161383_2010_3197 | 395 |
| 171 | 3300042659 | Ga0466733_008626 | Ga0466733_008626_46608_47795 | 395 |
| 172 | 3300042659 | Ga0466733_079693 | Ga0466733_079693_975_2168 | 397 |
| 173 | 3300010167 | Ga0123353_10496840 | Ga0123353_104968401 | 400 |
| 174 | 3300042619 | Ga0466726_272855 | Ga0466726_272855_2153_3358 | 401 |
| 175 | 3300010167 | Ga0123353_10487413 | Ga0123353_104874131 | 402 |
| 176 | 3300010167 | Ga0123353_10547632 | Ga0123353_105476321 | 403 |
| 177 | 3300010882 | Ga0123354_10287291 | Ga0123354_102872911 | 406 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01637 | ATPase_2 | ATPase domain predominantly from Archaea | 16 | 257 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01637 | GO:0005524 | ATP binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.