Protein Family IF03527

Metagenome Isolate
150 Members
46 Samples
138 Scaffolds
373.04 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10212446|Ga0123354_102124462
Length
431 aa
Sequence
VPRSGLRRDPLTIHERTLTNANEHIDNEMSVYDNGRYWGKGFSIKDSGRKARGKPMDDRQRLRAVLNYEDYDRLPVVHFGFWTELLEKWVAEGHLKPEEIIGATDGTENEALIEEKLGFDFNYYTTFQDLSGFGSLWPPFEEKIVRKYDDGRYEYLNEYGVTELRKPGVTCIGAEIAHTLVDRESWEEHYLPRLSFGEDRYDPQLVSKLVAESGTRSRPLGLYCKSLYGVIRNWMGVEGLCLLPAEDEELYDEIIATLADLTYKTVKRGLETGVAFDFAHYWEDIAFKNGPLVNPKVFMEKIGPHYRRISDLLHSYGVNIISLDCDGVIDLLIPTWIENGVNTMFPIEVGTWGASIAPWREKYGRELRGVGGVNKHVMSYDRAAVDAEIERLKPLVDLGGFLPCPDHRLPVDNKWELVQYYCERMRREFS*

πŸ“Š Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 31.8%
Unclassified 29.5%
Kalotermitidae 27.3%
Rhinotermitidae 4.5%
Passalidae 4.5%
Termopsidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
2 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
11 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
27 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
32 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
33 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
36 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_322235 3300042612 Bacteria 1669
2 Ga0466704_468749 3300042643 Bacteria 3562
3 Ga0466704_576915 3300042643 Unclassified 28291
4 Ga0466713_146819 3300042602 Bacteria 8334
5 Ga0072941_1469684 3300005201 Bacteria 1691
6 Ga0123355_10051031 3300009826 Bacteria 6715
7 Ga0123355_10120889 3300009826 Bacteria 4063
8 Ga0123356_10002505 3300010049 Bacteria 19613
9 Ga0123356_10190139 3300010049 Bacteria 2083
10 Ga0123356_10451530 3300010049 Bacteria 1434
11 Ga0123353_10009513 3300010167 Bacteria 13430
12 Ga0123353_10026728 3300010167 Bacteria 8823
13 Ga0123353_10178169 3300010167 Bacteria 3368
14 Ga0123353_10299871 3300010167 Bacteria 2454
15 Ga0466711_170652 3300042615 Bacteria 4095
16 Ga0466711_272007 3300042615 Bacteria 4788
17 Ga0466715_327404 3300042616 Bacteria 40969
18 Ga0466726_294773 3300042619 Bacteria 2703
19 Ga0466726_337077 3300042619 Bacteria 19306
20 Ga0123357_10008370 3300009784 Bacteria 12912
21 Ga0123355_10005076 3300009826 Bacteria 19177
22 Ga0123355_10011416 3300009826 Bacteria 13690
23 Ga0123356_10019082 3300010049 Bacteria 6503
24 Ga0123356_10152074 3300010049 Bacteria 2299
25 Ga0123356_10212026 3300010049 Bacteria 1986
26 Ga0123353_10039486 3300010167 Bacteria 7431
27 Ga0123353_10078539 3300010167 Bacteria 5304
28 Ga0123354_10194094 3300010882 Bacteria 2261
29 Ga0466705_216532 3300042612 Bacteria 9063
30 Ga0415639_094389 3300038395 Bacteria 1947
31 Ga0466694_111132 3300042594 Bacteria 4028
32 Ga0466696_147013 3300042596 Bacteria 2887
33 Ga0466703_337104 3300042636 Bacteria 1339
34 Ga0466709_106149 3300042648 Bacteria 11971
35 2227594083 2225789004 Bacteria 12742
36 JGI24702J35022_10000121 3300002462 Bacteria 37809
37 Ga0123355_10015516 3300009826 Bacteria 11975
38 Ga0123355_10091888 3300009826 Bacteria 4810
39 Ga0123356_10041918 3300010049 Bacteria 4266
40 Ga0123356_10124155 3300010049 Bacteria 2517
41 Ga0123356_10184038 3300010049 Bacteria 2113
42 Ga0123356_10255124 3300010049 Bacteria 1834
43 Ga0123353_10272405 3300010167 Bacteria 2607
44 Ga0123353_10520161 3300010167 Bacteria 1727
45 Ga0466697_063875 3300042611 Bacteria 1210
46 Ga0264413_148919 3300024493 Bacteria 1576
47 Ga0415639_004585 3300038395 Bacteria 2927
48 Ga0466692_171107 3300042591 Bacteria 16200
49 Ga0466691_026746 3300042593 Bacteria 8922
50 Ga0466708_339418 3300042652 Bacteria 4067
51 Ga0466715_635585 3300042616 Bacteria 2887
52 Ga0466707_293337 3300042601 Bacteria 2845
53 Ga0466713_002219 3300042602 Bacteria 61454
54 Ga0123357_10254863 3300009784 Bacteria 1868
55 Ga0123355_10065910 3300009826 Bacteria 5831
56 Ga0123355_10081461 3300009826 Bacteria 5165
57 Ga0123356_10002559 3300010049 Bacteria 19424
58 Ga0123356_10133665 3300010049 Bacteria 2435
59 Ga0466697_196534 3300042611 Bacteria 1998
60 Ga0466733_044609 3300042659 Bacteria 1299
61 Ga0415639_001857 3300038395 Bacteria 49774
62 Ga0415639_189388 3300038395 Bacteria 1518
63 Ga0456237_0010280 3300041968 Unclassified 1383
64 Ga0466704_232911 3300042643 Bacteria 23692
65 Ga0466709_164814 3300042648 Bacteria 4029
66 Ga0466728_338876 3300042620 Unclassified 5115
67 Ga0466721_036157 3300042608 Bacteria 12431
68 IMNBL1DRAFT_c0021183 3300000062 Bacteria 2609
69 Ga0123355_10009336 3300009826 Bacteria 14896
70 Ga0123355_10041580 3300009826 Bacteria 7484
71 Ga0123355_10102287 3300009826 Bacteria 4506
72 Ga0123356_10000042 3300010049 Bacteria 135091
73 Ga0123356_10079837 3300010049 Bacteria 3091
74 Ga0123356_10343984 3300010049 Bacteria 1613
75 Ga0123353_10010494 3300010167 Bacteria 12917
76 Ga0123353_10031087 3300010167 Bacteria 8262
77 Ga0123353_10156227 3300010167 Bacteria 3636
78 Ga0123353_10214326 3300010167 Bacteria 3018
79 Ga0123353_10272495 3300010167 Bacteria 2606
80 Ga0123353_10299206 3300010167 Bacteria 2457
81 Ga0123354_10078697 3300010882 Bacteria 4685
82 Ga0466696_080624 3300042596 Bacteria 13219
83 Ga0466696_207904 3300042596 Bacteria 4599
84 Ga0466703_399092 3300042636 Bacteria 3226
85 Ga0466715_139457 3300042616 Bacteria 10228
86 Ga0466715_180284 3300042616 Bacteria 17847
87 Ga0466723_155784 3300042618 Bacteria 4437
88 Ga0466717_047411 3300042604 Bacteria 1354
89 Ga0466719_123269 3300042606 Bacteria 9947
90 JGI24695J34938_10001149 3300002450 Bacteria 23628
91 Ga0123355_10013098 3300009826 Bacteria 12881
92 Ga0123356_10003469 3300010049 Bacteria 16491
93 Ga0123356_10421129 3300010049 Bacteria 1477
94 Ga0123353_10003425 3300010167 Bacteria 20034
95 Ga0123353_10006627 3300010167 Bacteria 15468
96 Ga0123353_10094522 3300010167 Bacteria 4816
97 Ga0123353_10382044 3300010167 Bacteria 2106
98 Ga0123353_10652337 3300010167 Bacteria 1490
99 Ga0123354_10212446 3300010882 Bacteria 2086
100 Ga0466697_166360 3300042611 Bacteria 2518
101 Ga0415639_161616 3300038395 Bacteria 1596
102 Ga0466704_418677 3300042643 Bacteria 6436
103 Ga0466708_414615 3300042652 Bacteria 2948
104 IMNBL1DRAFT_c0000423 3300000062 Bacteria 35519
105 IMNBL1DRAFT_c0002247 3300000062 Bacteria 13602
106 IMNBL1DRAFT_c0013451 3300000062 Bacteria 3668
107 Ga0123355_10433993 3300009826 Bacteria 1668
108 Ga0123355_10458797 3300009826 Bacteria 1600
109 Ga0123356_10217452 3300010049 Bacteria 1965
110 Ga0123356_10402156 3300010049 Bacteria 1507
111 Ga0123353_10144509 3300010167 Bacteria 3805
112 Ga0123353_10147846 3300010167 Bacteria 3755
113 Ga0123353_10161160 3300010167 Bacteria 3571
114 Ga0123353_10209950 3300010167 Bacteria 3055
115 Ga0123353_10386615 3300010167 Bacteria 2090
116 Ga0466705_174804 3300042612 Bacteria 3816
117 Ga0466705_363436 3300042612 Bacteria 3811
118 Ga0415639_159868 3300038395 Bacteria 2747
119 Ga0466723_088893 3300042618 Bacteria 6749
120 Ga0466723_368534 3300042618 Bacteria 4668
121 Ga0466713_051579 3300042602 Bacteria 12431
122 Ga0466714_060322 3300042603 Bacteria 17353
123 IMNBL1DRAFT_c0000164 3300000062 Bacteria 59044
124 JGI24702J35022_10019734 3300002462 Bacteria 3665
125 Ga0123357_10011375 3300009784 Bacteria 11403
126 Ga0123357_10335166 3300009784 Bacteria 1472
127 Ga0123355_10007904 3300009826 Bacteria 16020
128 Ga0123356_10014804 3300010049 Bacteria 7490
129 Ga0123356_10057001 3300010049 Bacteria 3641
130 Ga0123356_10119182 3300010049 Bacteria 2563
131 Ga0123356_10312171 3300010049 Bacteria 1682
132 Ga0123353_10004192 3300010167 Bacteria 18509
133 Ga0123353_10023138 3300010167 Bacteria 9398
134 Ga0123353_10080402 3300010167 Bacteria 5242
135 Ga0123353_10131953 3300010167 Bacteria 4008
136 Ga0123353_10261775 3300010167 Bacteria 2671
137 Ga0123353_10437064 3300010167 Bacteria 1932
138 Ga0123353_10448902 3300010167 Bacteria 1899

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_164814 Ga0466709_164814_257_1207 316
2 3300038395 Ga0415639_189388 Ga0415639_189388_235_1293 347
3 iso_pr_bacteria 2820193510 2820194019 351
4 3300010167 Ga0123353_10209950 Ga0123353_102099503 354
5 3300010049 Ga0123356_10079837 Ga0123356_100798372 357
6 3300010167 Ga0123353_10039486 Ga0123353_100394864 357
7 3300010167 Ga0123353_10386615 Ga0123353_103866152 357
8 3300042594 Ga0466694_111132 Ga0466694_111132_576_1652 358
9 3300010167 Ga0123353_10261775 Ga0123353_102617753 359
10 3300038395 Ga0415639_001857 Ga0415639_001857_3919_4998 359
11 3300009784 Ga0123357_10335166 Ga0123357_103351661 360
12 3300009826 Ga0123355_10011416 Ga0123355_100114163 360
13 3300009826 Ga0123355_10065910 Ga0123355_100659102 360
14 3300010049 Ga0123356_10184038 Ga0123356_101840382 361
15 3300000062 IMNBL1DRAFT_c0021183 IMNBL1DRAFT_00211833 362
16 3300042616 Ga0466715_180284 Ga0466715_180284_9823_10911 362
17 iso_pr_bacteria 2820408893 2820410287 362
18 3300010167 Ga0123353_10178169 Ga0123353_101781692 363
19 3300010167 Ga0123353_10299206 Ga0123353_102992063 363
20 3300010882 Ga0123354_10078697 Ga0123354_100786973 363
21 iso_pr_bacteria 2781125661 2781331990 363
22 3300002450 JGI24695J34938_10001149 JGI24695J34938_1000114917 364
23 3300010049 Ga0123356_10000042 Ga0123356_1000004211 364
24 3300010049 Ga0123356_10041918 Ga0123356_100419183 364
25 3300010167 Ga0123353_10023138 Ga0123353_100231385 364
26 3300010167 Ga0123353_10272495 Ga0123353_102724952 364
27 3300042608 Ga0466721_036157 Ga0466721_036157_6516_7610 364
28 3300042611 Ga0466697_063875 Ga0466697_063875_57_1151 364
29 iso_pr_bacteria 2820277137 2820278715 364
30 3300010049 Ga0123356_10057001 Ga0123356_100570013 365
31 3300010049 Ga0123356_10312171 Ga0123356_103121712 365
32 3300010167 Ga0123353_10299871 Ga0123353_102998712 365
33 3300010049 Ga0123356_10019082 Ga0123356_100190824 366
34 3300010049 Ga0123356_10217452 Ga0123356_102174522 366
35 3300010049 Ga0123356_10451530 Ga0123356_104515302 366
36 3300042619 Ga0466726_337077 Ga0466726_337077_9152_10252 366
37 3300042643 Ga0466704_468749 Ga0466704_468749_1795_2913 366
38 3300010049 Ga0123356_10119182 Ga0123356_101191823 367
39 3300010049 Ga0123356_10421129 Ga0123356_104211292 367
40 3300010167 Ga0123353_10080402 Ga0123353_100804024 367
41 3300010049 Ga0123356_10343984 Ga0123356_103439842 368
42 3300010167 Ga0123353_10094522 Ga0123353_100945221 368
43 3300038395 Ga0415639_094389 Ga0415639_094389_153_1259 368
44 iso_pr_bacteria 2820525019 2820526327 368
45 3300009826 Ga0123355_10015516 Ga0123355_100155168 369
46 3300042603 Ga0466714_060322 Ga0466714_060322_5660_6769 369
47 3300042643 Ga0466704_418677 Ga0466704_418677_3649_4758 369
48 3300010167 Ga0123353_10437064 Ga0123353_104370642 370
49 3300042602 Ga0466713_002219 Ga0466713_002219_1596_2708 370
50 3300042604 Ga0466717_047411 Ga0466717_047411_62_1174 370
51 3300009826 Ga0123355_10120889 Ga0123355_101208894 371
52 3300010049 Ga0123356_10003469 Ga0123356_100034699 371
53 3300010049 Ga0123356_10124155 Ga0123356_101241552 371
54 3300010167 Ga0123353_10006627 Ga0123353_100066272 371
55 3300010167 Ga0123353_10078539 Ga0123353_100785393 371
56 3300038395 Ga0415639_161616 Ga0415639_161616_330_1445 371
57 3300042601 Ga0466707_293337 Ga0466707_293337_778_1893 371
58 2225789004 2227594083 2228155640 372
59 3300005201 Ga0072941_1469684 Ga0072941_14696842 372
60 3300009826 Ga0123355_10007904 Ga0123355_100079045 372
61 3300010167 Ga0123353_10144509 Ga0123353_101445091 372
62 3300010167 Ga0123353_10147846 Ga0123353_101478463 372
63 3300038395 Ga0415639_159868 Ga0415639_159868_434_1552 372
64 3300042611 Ga0466697_196534 Ga0466697_196534_285_1403 372
65 3300000062 IMNBL1DRAFT_c0000164 IMNBL1DRAFT_000016424 373
66 3300000062 IMNBL1DRAFT_c0000423 IMNBL1DRAFT_000042331 373
67 3300000062 IMNBL1DRAFT_c0002247 IMNBL1DRAFT_00022477 373
68 3300009826 Ga0123355_10041580 Ga0123355_100415807 373
69 3300010167 Ga0123353_10026728 Ga0123353_100267286 373
70 3300042602 Ga0466713_051579 Ga0466713_051579_6817_7938 373
71 3300042602 Ga0466713_146819 Ga0466713_146819_4091_5212 373
72 3300009784 Ga0123357_10254863 Ga0123357_102548632 374
73 3300009826 Ga0123355_10081461 Ga0123355_100814612 374
74 3300038395 Ga0415639_004585 Ga0415639_004585_834_1958 374
75 iso_pr_bacteria 2820265624 2820266553 374
76 3300000062 IMNBL1DRAFT_c0013451 IMNBL1DRAFT_00134514 375
77 3300009826 Ga0123355_10051031 Ga0123355_100510315 375
78 3300010049 Ga0123356_10255124 Ga0123356_102551241 375
79 3300010167 Ga0123353_10004192 Ga0123353_1000419212 375
80 3300010167 Ga0123353_10131953 Ga0123353_101319532 375
81 iso_pr_bacteria 2820272499 2820272547 375
82 iso_pr_bacteria 2820332331 2820333221 375
83 3300002462 JGI24702J35022_10019734 JGI24702J35022_100197343 376
84 3300009784 Ga0123357_10011375 Ga0123357_100113756 376
85 3300009826 Ga0123355_10005076 Ga0123355_1000507616 376
86 3300010049 Ga0123356_10002505 Ga0123356_100025057 376
87 3300010049 Ga0123356_10014804 Ga0123356_100148042 376
88 3300010049 Ga0123356_10212026 Ga0123356_102120262 376
89 3300010167 Ga0123353_10009513 Ga0123353_100095136 376
90 3300010167 Ga0123353_10214326 Ga0123353_102143262 376
91 3300010167 Ga0123353_10382044 Ga0123353_103820442 376
92 3300010167 Ga0123353_10448902 Ga0123353_104489021 376
93 3300010167 Ga0123353_10520161 Ga0123353_105201611 376
94 3300041968 Ga0456237_0010280 Ga0456237_0010280_168_1298 376
95 3300042659 Ga0466733_044609 Ga0466733_044609_35_1165 376
96 3300009826 Ga0123355_10013098 Ga0123355_100130988 377
97 3300009826 Ga0123355_10433993 Ga0123355_104339931 377
98 3300010049 Ga0123356_10133665 Ga0123356_101336651 377
99 3300010049 Ga0123356_10152074 Ga0123356_101520742 377
100 3300010049 Ga0123356_10190139 Ga0123356_101901391 377
101 3300010167 Ga0123353_10031087 Ga0123353_100310873 377
102 3300010167 Ga0123353_10156227 Ga0123353_101562275 377
103 3300010167 Ga0123353_10161160 Ga0123353_101611603 377
104 3300010167 Ga0123353_10272405 Ga0123353_102724052 377
105 3300010882 Ga0123354_10194094 Ga0123354_101940942 377
106 3300024493 Ga0264413_148919 Ga0264413_1489192 377
107 3300042615 Ga0466711_170652 Ga0466711_170652_670_1803 377
108 3300042616 Ga0466715_327404 Ga0466715_327404_3296_4429 377
109 3300010049 Ga0123356_10402156 Ga0123356_104021562 378
110 3300010167 Ga0123353_10652337 Ga0123353_106523372 378
111 3300010049 Ga0123356_10002559 Ga0123356_1000255916 379
112 3300010167 Ga0123353_10003425 Ga0123353_1000342511 379
113 3300010167 Ga0123353_10010494 Ga0123353_100104946 379
114 iso_pr_bacteria 2820223845 2820224167 379
115 3300002462 JGI24702J35022_10000121 JGI24702J35022_1000012119 380
116 3300009826 Ga0123355_10091888 Ga0123355_100918883 380
117 3300042593 Ga0466691_026746 Ga0466691_026746_6568_7710 380
118 3300042596 Ga0466696_080624 Ga0466696_080624_11770_12912 380
119 3300042596 Ga0466696_207904 Ga0466696_207904_2128_3270 380
120 3300042611 Ga0466697_166360 Ga0466697_166360_596_1738 380
121 3300042612 Ga0466705_174804 Ga0466705_174804_2144_3286 380
122 3300042612 Ga0466705_322235 Ga0466705_322235_499_1641 380
123 3300042612 Ga0466705_363436 Ga0466705_363436_758_1900 380
124 3300042618 Ga0466723_155784 Ga0466723_155784_1557_2699 380
125 3300042619 Ga0466726_294773 Ga0466726_294773_361_1503 380
126 3300042620 Ga0466728_338876 Ga0466728_338876_411_1553 380
127 3300042636 Ga0466703_337104 Ga0466703_337104_175_1317 380
128 3300042643 Ga0466704_232911 Ga0466704_232911_850_1992 380
129 3300042643 Ga0466704_576915 Ga0466704_576915_4765_5907 380
130 3300042648 Ga0466709_106149 Ga0466709_106149_5451_6593 380
131 3300042652 Ga0466708_339418 Ga0466708_339418_2701_3843 380
132 3300042652 Ga0466708_414615 Ga0466708_414615_278_1420 380
133 iso_pr_bacteria 2820367663 2820367831 380
134 3300042591 Ga0466692_171107 Ga0466692_171107_929_2074 381
135 3300042606 Ga0466719_123269 Ga0466719_123269_609_1754 381
136 3300042612 Ga0466705_216532 Ga0466705_216532_6835_7980 381
137 3300042615 Ga0466711_272007 Ga0466711_272007_274_1419 381
138 3300042616 Ga0466715_139457 Ga0466715_139457_62_1207 381
139 3300042618 Ga0466723_368534 Ga0466723_368534_3480_4625 381
140 3300042636 Ga0466703_399092 Ga0466703_399092_1786_2931 381
141 3300042616 Ga0466715_635585 Ga0466715_635585_249_1397 382
142 iso_pr_bacteria 2820189034 2820192166 382
143 iso_pr_bacteria 2820367663 2820368778 382
144 3300009784 Ga0123357_10008370 Ga0123357_100083702 383
145 3300042618 Ga0466723_088893 Ga0466723_088893_5175_6326 383
146 3300009826 Ga0123355_10458797 Ga0123355_104587972 386
147 3300009826 Ga0123355_10102287 Ga0123355_101022871 397
148 3300009826 Ga0123355_10009336 Ga0123355_100093365 404
149 3300042596 Ga0466696_147013 Ga0466696_147013_31_1305 424
150 3300010882 Ga0123354_10212446 Ga0123354_102124462 431

🧩 MSA Aligner

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.