Protein Family IF03519
Metagenome
Isolate
120
Members
49
Samples
117
Scaffolds
379.21
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10170608|Ga0123354_101706082
- Length
- 412 aa
- Sequence
- LYLCTANYHDNLVYDQKLSSLRNIYMTEIQENSYIRKQIFEGAENESVFLWGARQTGKSTLMRELFPNAMYIDLLLATEYRKYLANPEILRETLLLNKEIKTVVIDEIPMLPSLLNEIHWLIENAGIRFVMSGSSPRKILRSGVNLLGGRALRYELYPLVSSEIPDFDLLKALNNGLLPRHYKAKNAAKMLNAYIGSYLRDEIIAEARIRDVPAFTKFLEISAITNGEMVNYSNIAADVGVAVSTVKTYFQILEDTLLGRYLPSYQKKPKRRVITAPKFYLFDVGIANSLLNRPKIDYGTEIFGKAFEHFIYQEIYAHSRYSDWNYKISYWRTASQLEIDFVLGENEVAIEVKSTDNANHRHLKGLLSFSEEYTVKKSILICNDPYPRLVGNILILPWKIFLERLWGGEII*
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.8%
Kalotermitidae
27.1%
Unclassified
10.4%
Rhinotermitidae
6.2%
Termopsidae
6.2%
Passalidae
2.1%
Armadillidiidae
2.1%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_028892 | 3300042601 | Bacteria | 14574 |
| 2 | Ga0466719_045804 | 3300042606 | Bacteria | 7621 |
| 3 | Ga0466721_129208 | 3300042608 | Bacteria | 29268 |
| 4 | Ga0466722_107298 | 3300042609 | Bacteria | 4914 |
| 5 | Ga0466718_105935 | 3300042617 | Bacteria | 4122 |
| 6 | Ga0466728_427511 | 3300042620 | Bacteria | 4340 |
| 7 | Ga0123357_10173901 | 3300009784 | Bacteria | 2538 |
| 8 | Ga0123353_10287982 | 3300010167 | Bacteria | 2517 |
| 9 | Ga0123354_10292942 | 3300010882 | Unclassified | 1556 |
| 10 | Ga0466734_087234 | 3300042623 | Bacteria | 1795 |
| 11 | Ga0466703_096317 | 3300042636 | Bacteria | 7051 |
| 12 | Ga0466697_212524 | 3300042611 | Bacteria | 1776 |
| 13 | Ga0466705_333917 | 3300042612 | Bacteria | 1767 |
| 14 | JGI24702J35022_10011699 | 3300002462 | Bacteria | 4891 |
| 15 | Ga0123357_10000151 | 3300009784 | Bacteria | 61706 |
| 16 | Ga0466713_096760 | 3300042602 | Bacteria | 2458 |
| 17 | Ga0466710_188472 | 3300042613 | Bacteria | 2045 |
| 18 | Ga0466712_032009 | 3300042614 | Bacteria | 4110 |
| 19 | Ga0466715_374590 | 3300042616 | Bacteria | 52714 |
| 20 | Ga0123356_10069767 | 3300010049 | Bacteria | 3296 |
| 21 | Ga0123356_10088383 | 3300010049 | Unclassified | 2946 |
| 22 | Ga0123353_10123913 | 3300010167 | Bacteria | 4154 |
| 23 | Ga0466704_116022 | 3300042643 | Bacteria | 1358 |
| 24 | Ga0466704_288448 | 3300042643 | Bacteria | 5508 |
| 25 | Ga0466708_400105 | 3300042652 | Bacteria | 4562 |
| 26 | Ga0466697_162558 | 3300042611 | Bacteria | 2912 |
| 27 | IMNBL1DRAFT_c0014086 | 3300000062 | Bacteria | 3552 |
| 28 | Ga0466721_155821 | 3300042608 | Bacteria | 5937 |
| 29 | Ga0466711_322062 | 3300042615 | Bacteria | 8945 |
| 30 | Ga0466690_050481 | 3300042590 | Bacteria | 5374 |
| 31 | Ga0466694_354527 | 3300042594 | Bacteria | 1779 |
| 32 | Ga0466696_472039 | 3300042596 | Bacteria | 1970 |
| 33 | Ga0123356_10103079 | 3300010049 | Bacteria | 2740 |
| 34 | Ga0123354_10178258 | 3300010882 | Bacteria | 2438 |
| 35 | Ga0466729_261735 | 3300042621 | Bacteria | 1586 |
| 36 | Ga0466724_48342 | 3300042649 | Bacteria | 7538 |
| 37 | Ga0466727_143669 | 3300042655 | Bacteria | 1455 |
| 38 | Ga0466727_225706 | 3300042655 | Bacteria | 2143 |
| 39 | Ga0466697_188064 | 3300042611 | Bacteria | 1864 |
| 40 | JGI24695J34938_10028655 | 3300002450 | Bacteria | 2614 |
| 41 | Ga0123357_10000769 | 3300009784 | Bacteria | 32386 |
| 42 | Ga0466701_069723 | 3300042598 | Bacteria | 1364 |
| 43 | Ga0466707_163059 | 3300042601 | Bacteria | 74413 |
| 44 | Ga0466707_186482 | 3300042601 | Bacteria | 8277 |
| 45 | Ga0466710_378438 | 3300042613 | Bacteria | 2339 |
| 46 | Ga0466729_052115 | 3300042621 | Bacteria | 1587 |
| 47 | Ga0160456_100049 | 3300012820 | Bacteria | 189296 |
| 48 | Ga0466693_409261 | 3300042592 | Bacteria | 1595 |
| 49 | Ga0466691_039196 | 3300042593 | Unclassified | 8257 |
| 50 | Ga0123356_10149251 | 3300010049 | Bacteria | 2318 |
| 51 | Ga0123353_10544260 | 3300010167 | Bacteria | 1676 |
| 52 | Ga0123354_10167712 | 3300010882 | Bacteria | 2572 |
| 53 | Ga0466735_070279 | 3300042624 | Bacteria | 1244 |
| 54 | AustNasuHG_c1030603 | 3300000089 | Bacteria | 1545 |
| 55 | Ga0466707_216551 | 3300042601 | Bacteria | 9453 |
| 56 | Ga0466716_010138 | 3300042605 | Bacteria | 21092 |
| 57 | Ga0466715_278394 | 3300042616 | Bacteria | 1588 |
| 58 | Ga0466693_075482 | 3300042592 | Bacteria | 2656 |
| 59 | Ga0466691_074851 | 3300042593 | Bacteria | 71488 |
| 60 | Ga0123353_10012436 | 3300010167 | Bacteria | 12100 |
| 61 | Ga0123354_10000510 | 3300010882 | Bacteria | 39203 |
| 62 | Ga0466731_267757 | 3300042622 | Bacteria | 1381 |
| 63 | Ga0466703_193800 | 3300042636 | Bacteria | 1893 |
| 64 | Ga0466703_340785 | 3300042636 | Bacteria | 1970 |
| 65 | IMNBL1DRAFT_c0022833 | 3300000062 | Bacteria | 2465 |
| 66 | Ga0072941_1081146 | 3300005201 | Bacteria | 6632 |
| 67 | Ga0466707_270832 | 3300042601 | Bacteria | 16847 |
| 68 | Ga0466716_386886 | 3300042605 | Bacteria | 1783 |
| 69 | Ga0466719_243229 | 3300042606 | Bacteria | 14378 |
| 70 | Ga0466722_230168 | 3300042609 | Bacteria | 9344 |
| 71 | Ga0466715_149116 | 3300042616 | Bacteria | 4143 |
| 72 | Ga0466715_489218 | 3300042616 | Bacteria | 2051 |
| 73 | Ga0466726_186204 | 3300042619 | Bacteria | 2280 |
| 74 | Ga0466728_376332 | 3300042620 | Bacteria | 1709 |
| 75 | Ga0466691_057155 | 3300042593 | Bacteria | 3404 |
| 76 | Ga0123353_10050501 | 3300010167 | Bacteria | 6631 |
| 77 | Ga0123354_10100475 | 3300010882 | Bacteria | 3915 |
| 78 | Ga0123354_10170608 | 3300010882 | Bacteria | 2534 |
| 79 | Ga0123354_10249914 | 3300010882 | Bacteria | 1800 |
| 80 | Ga0466734_082710 | 3300042623 | Unclassified | 1591 |
| 81 | Ga0466703_284748 | 3300042636 | Bacteria | 2749 |
| 82 | Ga0466727_153429 | 3300042655 | Bacteria | 1382 |
| 83 | Ga0466727_348162 | 3300042655 | Bacteria | 8352 |
| 84 | JGI24705J35276_12238303 | 3300002504 | Bacteria | 18959 |
| 85 | Ga0123357_10000530 | 3300009784 | Bacteria | 37490 |
| 86 | Ga0466700_397915 | 3300042600 | Bacteria | 5182 |
| 87 | Ga0466707_071485 | 3300042601 | Bacteria | 3394 |
| 88 | Ga0466707_306272 | 3300042601 | Unclassified | 2207 |
| 89 | Ga0466707_402033 | 3300042601 | Bacteria | 7974 |
| 90 | Ga0466714_088518 | 3300042603 | Bacteria | 7359 |
| 91 | Ga0466719_015151 | 3300042606 | Bacteria | 3031 |
| 92 | Ga0466722_205060 | 3300042609 | Bacteria | 8320 |
| 93 | Ga0466690_013226 | 3300042590 | Bacteria | 6890 |
| 94 | Ga0466690_290874 | 3300042590 | Bacteria | 5914 |
| 95 | Ga0466692_107258 | 3300042591 | Bacteria | 24514 |
| 96 | Ga0466691_138483 | 3300042593 | Bacteria | 1639 |
| 97 | Ga0123356_10009546 | 3300010049 | Bacteria | 9578 |
| 98 | Ga0123353_10065821 | 3300010167 | Bacteria | 5817 |
| 99 | Ga0466731_238072 | 3300042622 | Bacteria | 1498 |
| 100 | Ga0466705_103461 | 3300042612 | Bacteria | 18180 |
| 101 | Ga0466707_288967 | 3300042601 | Bacteria | 3584 |
| 102 | Ga0466698_191572 | 3300042610 | Bacteria | 2139 |
| 103 | Ga0466723_019458 | 3300042618 | Bacteria | 7399 |
| 104 | Ga0466726_028688 | 3300042619 | Bacteria | 3539 |
| 105 | Ga0466728_040355 | 3300042620 | Bacteria | 37896 |
| 106 | Ga0466728_132683 | 3300042620 | Bacteria | 5229 |
| 107 | Ga0466729_082915 | 3300042621 | Bacteria | 3275 |
| 108 | Ga0466693_041735 | 3300042592 | Bacteria | 1610 |
| 109 | Ga0466696_057309 | 3300042596 | Bacteria | 8007 |
| 110 | Ga0123357_10033968 | 3300009784 | Bacteria | 6931 |
| 111 | Ga0123357_10211569 | 3300009784 | Bacteria | 2176 |
| 112 | Ga0123356_10002295 | 3300010049 | Bacteria | 20575 |
| 113 | Ga0123356_10006359 | 3300010049 | Bacteria | 11913 |
| 114 | Ga0123356_10063476 | 3300010049 | Bacteria | 3451 |
| 115 | Ga0123353_10460154 | 3300010167 | Bacteria | 1870 |
| 116 | Ga0466729_302278 | 3300042621 | Bacteria | 3571 |
| 117 | Ga0466735_009800 | 3300042624 | Bacteria | 5848 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042596 | Ga0466696_472039 | Ga0466696_472039_931_1959 | 342 |
| 2 | 3300042611 | Ga0466697_212524 | Ga0466697_212524_719_1747 | 342 |
| 3 | 3300042643 | Ga0466704_116022 | Ga0466704_116022_285_1337 | 350 |
| 4 | 3300042619 | Ga0466726_028688 | Ga0466726_028688_1576_2718 | 358 |
| 5 | 3300042616 | Ga0466715_489218 | Ga0466715_489218_472_1611 | 363 |
| 6 | 3300042623 | Ga0466734_087234 | Ga0466734_087234_154_1308 | 363 |
| 7 | 3300042594 | Ga0466694_354527 | Ga0466694_354527_92_1231 | 365 |
| 8 | 3300000062 | IMNBL1DRAFT_c0022833 | IMNBL1DRAFT_00228331 | 367 |
| 9 | 3300042612 | Ga0466705_103461 | Ga0466705_103461_3809_4945 | 378 |
| 10 | 3300042621 | Ga0466729_082915 | Ga0466729_082915_111_1247 | 378 |
| 11 | 3300042590 | Ga0466690_013226 | Ga0466690_013226_4165_5304 | 379 |
| 12 | 3300042590 | Ga0466690_050481 | Ga0466690_050481_4170_5309 | 379 |
| 13 | 3300042592 | Ga0466693_409261 | Ga0466693_409261_109_1248 | 379 |
| 14 | 3300042593 | Ga0466691_138483 | Ga0466691_138483_392_1531 | 379 |
| 15 | 3300042596 | Ga0466696_057309 | Ga0466696_057309_811_1950 | 379 |
| 16 | 3300042598 | Ga0466701_069723 | Ga0466701_069723_68_1207 | 379 |
| 17 | 3300042601 | Ga0466707_028892 | Ga0466707_028892_13125_14264 | 379 |
| 18 | 3300042601 | Ga0466707_163059 | Ga0466707_163059_46897_48036 | 379 |
| 19 | 3300042601 | Ga0466707_186482 | Ga0466707_186482_2874_4013 | 379 |
| 20 | 3300042601 | Ga0466707_216551 | Ga0466707_216551_4637_5776 | 379 |
| 21 | 3300042601 | Ga0466707_270832 | Ga0466707_270832_13502_14641 | 379 |
| 22 | 3300042601 | Ga0466707_288967 | Ga0466707_288967_1483_2622 | 379 |
| 23 | 3300042601 | Ga0466707_306272 | Ga0466707_306272_185_1324 | 379 |
| 24 | 3300042601 | Ga0466707_402033 | Ga0466707_402033_1071_2210 | 379 |
| 25 | 3300042602 | Ga0466713_096760 | Ga0466713_096760_1017_2156 | 379 |
| 26 | 3300042603 | Ga0466714_088518 | Ga0466714_088518_132_1271 | 379 |
| 27 | 3300042605 | Ga0466716_010138 | Ga0466716_010138_19344_20483 | 379 |
| 28 | 3300042606 | Ga0466719_243229 | Ga0466719_243229_13223_14362 | 379 |
| 29 | 3300042608 | Ga0466721_129208 | Ga0466721_129208_17039_18178 | 379 |
| 30 | 3300042608 | Ga0466721_155821 | Ga0466721_155821_4131_5270 | 379 |
| 31 | 3300042611 | Ga0466697_162558 | Ga0466697_162558_18_1157 | 379 |
| 32 | 3300042612 | Ga0466705_333917 | Ga0466705_333917_278_1417 | 379 |
| 33 | 3300042613 | Ga0466710_378438 | Ga0466710_378438_826_1965 | 379 |
| 34 | 3300042614 | Ga0466712_032009 | Ga0466712_032009_1929_3068 | 379 |
| 35 | 3300042615 | Ga0466711_322062 | Ga0466711_322062_1484_2623 | 379 |
| 36 | 3300042616 | Ga0466715_149116 | Ga0466715_149116_2782_3921 | 379 |
| 37 | 3300042616 | Ga0466715_278394 | Ga0466715_278394_386_1525 | 379 |
| 38 | 3300042617 | Ga0466718_105935 | Ga0466718_105935_1571_2710 | 379 |
| 39 | 3300042619 | Ga0466726_186204 | Ga0466726_186204_478_1617 | 379 |
| 40 | 3300042620 | Ga0466728_040355 | Ga0466728_040355_34781_35920 | 379 |
| 41 | 3300042621 | Ga0466729_052115 | Ga0466729_052115_176_1315 | 379 |
| 42 | 3300042621 | Ga0466729_302278 | Ga0466729_302278_482_1621 | 379 |
| 43 | 3300042622 | Ga0466731_238072 | Ga0466731_238072_253_1392 | 379 |
| 44 | 3300042622 | Ga0466731_267757 | Ga0466731_267757_231_1370 | 379 |
| 45 | 3300042623 | Ga0466734_082710 | Ga0466734_082710_305_1444 | 379 |
| 46 | 3300042624 | Ga0466735_009800 | Ga0466735_009800_4222_5361 | 379 |
| 47 | 3300042624 | Ga0466735_070279 | Ga0466735_070279_46_1185 | 379 |
| 48 | 3300042636 | Ga0466703_096317 | Ga0466703_096317_4770_5909 | 379 |
| 49 | 3300042636 | Ga0466703_340785 | Ga0466703_340785_570_1709 | 379 |
| 50 | 3300042643 | Ga0466704_288448 | Ga0466704_288448_2332_3471 | 379 |
| 51 | 3300042649 | Ga0466724_48342 | Ga0466724_48342_5068_6207 | 379 |
| 52 | 3300042655 | Ga0466727_348162 | Ga0466727_348162_6677_7816 | 379 |
| 53 | iso_pr_bacteria | 2820748953 | 2820750207 | 379 |
| 54 | iso_pr_bacteria | 2820778767 | 2820779091 | 379 |
| 55 | iso_pr_bacteria | 2820783511 | 2820784205 | 379 |
| 56 | 3300002450 | JGI24695J34938_10028655 | JGI24695J34938_100286552 | 380 |
| 57 | 3300002462 | JGI24702J35022_10011699 | JGI24702J35022_100116995 | 380 |
| 58 | 3300002504 | JGI24705J35276_12238303 | JGI24705J35276_1223830312 | 380 |
| 59 | 3300009784 | Ga0123357_10000151 | Ga0123357_1000015129 | 380 |
| 60 | 3300009784 | Ga0123357_10000530 | Ga0123357_1000053011 | 380 |
| 61 | 3300009784 | Ga0123357_10000769 | Ga0123357_100007699 | 380 |
| 62 | 3300009784 | Ga0123357_10033968 | Ga0123357_100339684 | 380 |
| 63 | 3300009784 | Ga0123357_10173901 | Ga0123357_101739011 | 380 |
| 64 | 3300009784 | Ga0123357_10211569 | Ga0123357_102115692 | 380 |
| 65 | 3300010049 | Ga0123356_10002295 | Ga0123356_1000229510 | 380 |
| 66 | 3300010049 | Ga0123356_10006359 | Ga0123356_100063594 | 380 |
| 67 | 3300010049 | Ga0123356_10069767 | Ga0123356_100697672 | 380 |
| 68 | 3300010049 | Ga0123356_10088383 | Ga0123356_100883832 | 380 |
| 69 | 3300010049 | Ga0123356_10103079 | Ga0123356_101030793 | 380 |
| 70 | 3300010049 | Ga0123356_10149251 | Ga0123356_101492511 | 380 |
| 71 | 3300010167 | Ga0123353_10012436 | Ga0123353_100124367 | 380 |
| 72 | 3300010167 | Ga0123353_10065821 | Ga0123353_100658212 | 380 |
| 73 | 3300010167 | Ga0123353_10123913 | Ga0123353_101239132 | 380 |
| 74 | 3300010167 | Ga0123353_10287982 | Ga0123353_102879821 | 380 |
| 75 | 3300010167 | Ga0123353_10460154 | Ga0123353_104601542 | 380 |
| 76 | 3300010167 | Ga0123353_10544260 | Ga0123353_105442601 | 380 |
| 77 | 3300010882 | Ga0123354_10000510 | Ga0123354_1000051026 | 380 |
| 78 | 3300010882 | Ga0123354_10100475 | Ga0123354_101004754 | 380 |
| 79 | 3300010882 | Ga0123354_10167712 | Ga0123354_101677122 | 380 |
| 80 | 3300010882 | Ga0123354_10178258 | Ga0123354_101782582 | 380 |
| 81 | 3300010882 | Ga0123354_10249914 | Ga0123354_102499142 | 380 |
| 82 | 3300010882 | Ga0123354_10292942 | Ga0123354_102929422 | 380 |
| 83 | 3300042590 | Ga0466690_290874 | Ga0466690_290874_4307_5449 | 380 |
| 84 | 3300042591 | Ga0466692_107258 | Ga0466692_107258_21051_22193 | 380 |
| 85 | 3300042593 | Ga0466691_039196 | Ga0466691_039196_6140_7282 | 380 |
| 86 | 3300042593 | Ga0466691_057155 | Ga0466691_057155_1819_2961 | 380 |
| 87 | 3300042605 | Ga0466716_386886 | Ga0466716_386886_311_1453 | 380 |
| 88 | 3300042606 | Ga0466719_015151 | Ga0466719_015151_579_1721 | 380 |
| 89 | 3300042606 | Ga0466719_045804 | Ga0466719_045804_2605_3747 | 380 |
| 90 | 3300042609 | Ga0466722_107298 | Ga0466722_107298_446_1588 | 380 |
| 91 | 3300042609 | Ga0466722_205060 | Ga0466722_205060_6515_7657 | 380 |
| 92 | 3300042616 | Ga0466715_374590 | Ga0466715_374590_13_1155 | 380 |
| 93 | 3300042618 | Ga0466723_019458 | Ga0466723_019458_5429_6571 | 380 |
| 94 | 3300042620 | Ga0466728_132683 | Ga0466728_132683_1041_2183 | 380 |
| 95 | 3300042620 | Ga0466728_427511 | Ga0466728_427511_1044_2186 | 380 |
| 96 | 3300042636 | Ga0466703_193800 | Ga0466703_193800_599_1741 | 380 |
| 97 | 3300042636 | Ga0466703_284748 | Ga0466703_284748_1227_2369 | 380 |
| 98 | 3300042652 | Ga0466708_400105 | Ga0466708_400105_426_1568 | 380 |
| 99 | 3300042655 | Ga0466727_143669 | Ga0466727_143669_262_1404 | 380 |
| 100 | 3300005201 | Ga0072941_1081146 | Ga0072941_10811462 | 381 |
| 101 | 3300010049 | Ga0123356_10009546 | Ga0123356_100095466 | 381 |
| 102 | 3300012820 | Ga0160456_100049 | Ga0160456_100049127 | 381 |
| 103 | 3300042600 | Ga0466700_397915 | Ga0466700_397915_2007_3152 | 381 |
| 104 | 3300042620 | Ga0466728_376332 | Ga0466728_376332_309_1454 | 381 |
| 105 | 3300000089 | AustNasuHG_c1030603 | AustNasuHG_10306032 | 382 |
| 106 | 3300010049 | Ga0123356_10063476 | Ga0123356_100634762 | 382 |
| 107 | 3300042592 | Ga0466693_075482 | Ga0466693_075482_386_1534 | 382 |
| 108 | 3300042601 | Ga0466707_071485 | Ga0466707_071485_109_1257 | 382 |
| 109 | 3300042610 | Ga0466698_191572 | Ga0466698_191572_827_1975 | 382 |
| 110 | 3300042611 | Ga0466697_188064 | Ga0466697_188064_524_1672 | 382 |
| 111 | 3300042621 | Ga0466729_261735 | Ga0466729_261735_237_1391 | 384 |
| 112 | 3300010167 | Ga0123353_10050501 | Ga0123353_1005050110 | 385 |
| 113 | 3300042655 | Ga0466727_153429 | Ga0466727_153429_74_1234 | 386 |
| 114 | 3300042655 | Ga0466727_225706 | Ga0466727_225706_645_1805 | 386 |
| 115 | 3300042613 | Ga0466710_188472 | Ga0466710_188472_275_1444 | 389 |
| 116 | 3300000062 | IMNBL1DRAFT_c0014086 | IMNBL1DRAFT_00140862 | 390 |
| 117 | 3300042609 | Ga0466722_230168 | Ga0466722_230168_7856_9040 | 394 |
| 118 | 3300042592 | Ga0466693_041735 | Ga0466693_041735_200_1399 | 399 |
| 119 | 3300042593 | Ga0466691_074851 | Ga0466691_074851_50888_52096 | 402 |
| 120 | 3300010882 | Ga0123354_10170608 | Ga0123354_101706082 | 412 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.